Dataset for protein Bim of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaavgvartgdaacgalscpaergsgraascrlsaapgaptaspglclpgrlrvdgqgapgrrraragrrrapartr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            *****************************************                           
------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQ---------------------------
rsegkgrtkkdq                                         gnpegegdrcpqgspqgplappaspgp

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************************
-----------------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQ
fatrsplfifvrrssllsrsssgyfsfdt                                                   

       250       260       270       280        
....:....|....:....|....:....|....:....|....:...
************************************************
ELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
                                                
© 1998-2020Legal notice