Dataset for protein Bim of organism Delphinapterus leucas

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9Q753_BCL2L11      MFPAAAVGVARTGDAACGALSCPAERGSGRAASCRLSAAPGAPTASPGLC
A0A2Y9Q753_BCL2L11      --------------------------------------------------
                                                                          

A0A2Y9Q753_BCL2L11      LPGRLRVDGQGAPGRRRARAGRRRAPARTRRSEGKGRTKKDQMAKQPSDV
A0A2Y9Q753_BCL2L11      ------------------------------------------MAKQPSDV
                                                                  ********

A0A2Y9Q753_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPISLQTERQ-----------------
A0A2Y9Q753_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQG
                        *********************************                 

A0A2Y9Q753_BCL2L11      ---------------------------------------DRSPAPMSCDK
A0A2Y9Q753_BCL2L11      PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
                                                               ***********

A0A2Y9Q753_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFN
A0A2Y9Q753_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFN
                        **************************************************

A0A2Y9Q753_BCL2L11      AYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
A0A2Y9Q753_BCL2L11      AYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
                        **************************************

© 1998-2021Legal notice