Dataset for protein classical BH3-containing proteins of organism Cyanistes caeruleus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                             .*. .                    ::   :           ...      
mdrpsyleedytsvdglg-vvshvttrxsg qpaereetgfftqnqsyscllcalqpfrighgrrsgrrr-eqqhlqsqi
          isklacgd difasddf l     amaa                 apf gccgpaigh d  dkaqaa

        90       100       110       120       130       140       150       160
                                                      :. .::  .      .*  .      
espssssqdvmlpcgvteeprrlfygsagyrlhvppagfvldphlqeepqegqrnaqpklqcpqkwqcra gennlrgqw
                                                        i  i ee aa   haghc r

       170       180       190       200    
fcg g   f  qfrgnehaa lg cqli le tr e        
© 1998-2023Legal notice