Dataset for protein classical BH3-containing proteins of organism Cyanistes caeruleus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0U4T1_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
A0A8C0UNY9_BCL2L11      ----------------------XXXXXXXGGREGGREG------------
A0A8C0UP29_PMAIP1-      ----------ITKVACGGDVISAVTTRGSAGREAAVAE------------
                                                     .*. .                

A0A8C0U4T1_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C0UNY9_BCL2L11      --GRMEPASFTGGRRSARGRPSRWQSQSAAE-------------------
A0A8C0UP29_PMAIP1-      --CALELSRIG----------DRWHLRQRIL-------------------
                            ::   :           ...                          

A0A8C0U4T1_BMF-01       RRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C0UNY9_BCL2L11      ----------------------------------EVQPEIWIAQELRRIG
A0A8C0UP29_PMAIP1-      ----------------------------------NVIAKLFCPETWAARG
                                                          :. .::  .      .

A0A8C0U4T1_BMF-01       DQFHRLHIQRLLLFSILLTTSTFSSVEHAAISGLCQLLILEITSLESVLT
A0A8C0UNY9_BCL2L11      DEFNASYCP------RRGFLDQQVGNPQVVILRLLRYIIRLIWRLQ----
A0A8C0UP29_PMAIP1-      DGERNGRGPWFCGFGRRGSTDSGR--------------------------
                        *  .                .                             

A0A8C0U4T1_BMF-01       LLVV
A0A8C0UNY9_BCL2L11      ----
A0A8C0UP29_PMAIP1-      ----
                            

© 1998-2022Legal notice