Dataset for protein classical BH3-containing proteins of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyrevrrgllprqlapaaataparatascrsplefapsfpiecgrqaprvlitldpgmspwrlmsrdltls
                                                                  aeeahhdaeaeiik
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--mpgqpsrpslaperelgvrqpedg---------rslgl-aq---d----r--------------gpltpcl-pgllp-
wv-mktvpqvqvvedlvgdqlksdprppqtrpgsp---d-v--srr-rpls-rqlwigdeldlawe--pgta-g--p-gs
tsla-emkpresecahadq-f--aesesglq  altwa-tfpggqlrcqagllpgf    msssprea--h-cavq-r-i
 lh-qr ehapcw ----al-st--ka cw    ildvqneevlpp ndvd clhy       rlqa yv-qvsl igst
  flpm rd ghg pfgw csrmr          sd   sd c nn g ga   ag       e l  rsgpar  gfaq
   hdc a      hc c apdik          m         e                  c c  qla     a  e
   c           a a     g                                         a  fi         d
                                                                     a          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--h-----------------------d--qa-nssasg-qg-m-pc-----y-------------l-asfrqrs-eprsp
srelfifvrrssllsrsssgyfsfdtqrs--t------t--v-p--svtss-qslnegndgyrle-pspipgsqp-gedi
iq-ac                     -qetqpmyphkssttpslirqrhnhptrgmyedasmeepaltrt-aglel-aqa
rpp                       mkap allcdhpgr ale qgafeealaaf spvpsirg  rnlm-qraswvvl
msn                        prl vd tqtqk  yfr  psl p  qhl     lap   kkg tkkwrt rg
flc                        hk  l      a  i g                        ga r isp    
e a                                                                    e a      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ppglw-------iare---------Lrrigdefnrsyk-----------h-------wlqvllfl--lvl-r--------
renqvqhraevrygqqqlfpmvllv-qcma-qlhgrhrrranpyqedqq-qhrpsrv-wrlir--vr-a-r-hgnrpgvg
t eilpkdvaqq---k          ---seaqeeqfivlrtnksagedtpqnrqmai---fqsiqnr-wnleesaesqe
s mt     sreqih-          lll- k ralwqgkpre    ta rmhqdpwrvny--qwws ptwklpr sem 
l dr      pdc ag               d  l qp  lq     d       asltmivtkvgl nap g g  a  
e ae      d                       f le                    fcfna mfd   g d       
                                                            ca   aa             
                                                            a                   

  
..
  
--
pw
 n
  
  
  
  
  
© 1998-2022Legal notice