Dataset for protein classical BH3-containing proteins of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8C2LX21_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Cricetulus griseus GN=HRK (length=92 residues).
MCPCPRHRGHGPPAVCGCSDTRPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|A0A8C2M216_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cricetulus griseus GN=BAD (length=184 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWEGPPGPCLAPGLLGSIRHQQEQAANSSHHGG
TGAMEIRSRHSSYTAGNEEDDGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
ASWTRIIQSWWDRNLGKGGSAPSQ
>gnl|bcl2dbpro|A0A8C2M216_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cricetulus griseus GN=BAD (length=153 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWEGPPGPCLAPGLLGSIRHQQEQAANSSHHGG
TGAMEIRSRHSSYTAGNEEDDGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVKLTPFRCVQ
>gnl|bcl2dbpro|A0A8C2M530_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cricetulus griseus GN=PMAIP1 (length=96 residues).
MLQRVARAELAPEFVAQLRRIGDKLSSEWCEPYITAPLSEMPNKKTRKSETRSPSPMRVPKDVEDECIHQLRRIGDKQNF
RQKLLNFITKLFSLVT
>gnl|bcl2dbpro|A0A8C2MKP2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Cricetulus griseus GN=BBC3 (length=175 residues).
MPPHPEVWPHCGWAGASCWRPGSSDWVGSVAVSPRDLGPFSGCVGVGGGPQFPCACQPKQALDLTASQKRGYLGPQPSLS
PAQQHLESPVPSAPEALAGGPTQAAPGVRGEEDEWAREIGAQLRRMADDLNAQYERRRQEDQHRHRPSPWRVMYNLFMGL
LPLPRDPGAPEMEPN
>gnl|bcl2dbpro|A0A8C2MZN7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cricetulus griseus GN=BMF (length=189 residues).
LFPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RDRAWWQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|A0A8C2MZN7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cricetulus griseus GN=BMF (length=270 residues).
MPGAGVFWKQYREVRRGLLPRQLAPAAATAPARATASCRSPLEFAPSFPIECGRQAPRVLITLDPGAEPWHHDSEAETLS
WSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQ
NRDRAWWQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|A0A8C2QK28_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGDGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQELRRIGDEFNES
YRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A8C2QK28_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADIRPEIWIAQELRRIGDEFNESYRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|A0A8C2QMK2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cricetulus griseus GN=BIK (length=151 residues).
MSEARLMARDLIIKTVLHDQVPRPPVAPGAPSMKDSMRDLDLVECLENRNQVALRLAYIGDEMDLCLRGPRLAQLPGIAM
HRLAVNYSQTGARGIFRSLIRGLTNLREKIWSWRVLTPGTWVSPDQARGQLFPMVLLVLLLLGEALHLQLQ
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice