Dataset for protein classical BH3-containing proteins of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3H020_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L11 (length=141 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADIRPEIWIAQELRRIGDEFNESYRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
>gnl|bcl2dbpro|G3H020_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGDGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQELRRIGDEFNES
YRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
© 1998-2020Legal notice