Dataset for protein Bmf of organism Coturnix japonica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ::           :.. ::  * :  ::*: * . ..  :*: .                                   
hqq-----------nrnqvw--WqlflflHnlAlnveanrnRtgqrsmtswghslsss----s--s---------g----
dkhgvltytrkilshktclylt yiecli hc qrqsvlpe stsieseglwt----allsa-ll-hhlhhsass-hccs
                                              ilpeys tpqk-iitd    apvfirllw etgv
                                               g d n q ee                       

       250       260  
....:....|....:....|..
                      
---qr-----------------
lat--cslgaempsaascglam
tqr  gkihp            
                      
© 1998-2022Legal notice