Dataset for protein Bmf of organism Coturnix japonica

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2TYD3_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C2TYD3_BMF-04      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C2TYD3_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C2TYD3_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C2TYD3_BMF-05      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A8C2TYD3_BMF-03      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C2TYD3_BMF-04      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C2TYD3_BMF-02      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C2TYD3_BMF-01      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C2TYD3_BMF-05      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A8C2TYD3_BMF-03      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A8C2TYD3_BMF-04      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A8C2TYD3_BMF-02      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A8C2TYD3_BMF-01      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A8C2TYD3_BMF-05      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
                       **************************************************

A0A8C2TYD3_BMF-03      DQFHRLHIQRDKHGVLTYTRKILSHKTCLYLTWYIECLIHHCAQRQSVLP
A0A8C2TYD3_BMF-04      DQFHRLHIQRHQQ-----------NRNQVW--WQLFLFLHNLALNVEANR
A0A8C2TYD3_BMF-02      DQFHRLHIQRHQQ-----------NRNQVW--WQLFLFLHNLALNVEANR
A0A8C2TYD3_BMF-01      DQFHRLHIQRHQQ-----------NRNQVW--WQLFLFLHNLALNVEANR
A0A8C2TYD3_BMF-05      DQFHRLHIQRHQQ-----------NRNQVW--WQLFLFLHNLALNVEANR
                       ********** ::           :.. ::  * :  ::*: * . ..  

A0A8C2TYD3_BMF-03      ERSTSISGTGLNH-------------------------------------
A0A8C2TYD3_BMF-04      NRTGQRISTEYSHTPEKS--------------------------------
A0A8C2TYD3_BMF-02      NRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCSLATQRCSLGA
A0A8C2TYD3_BMF-01      NRTGQREMESWGHSLSSALLSASLLSHHLHHSASSGHCCSLATQRCSLGA
A0A8C2TYD3_BMF-05      NRTGQRSLPDLWTQLQESIITDS--SAPVFIRLLWGETGVTQRQRGKIHP
                       :*: .                                             

A0A8C2TYD3_BMF-03      ------------
A0A8C2TYD3_BMF-04      ------------
A0A8C2TYD3_BMF-02      EMPSAASCGLAM
A0A8C2TYD3_BMF-01      EMPSAASCGLAM
A0A8C2TYD3_BMF-05      ------------
                                   

© 1998-2022Legal notice