Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
    mepsrgvkelkndvpgvedfqrsalvdtlsyadgfaqltme                vwgaphsr-dltssthcc 
       mpckea  da s  rpas etemlgaaqt r edk                      vtdqql af lsd a 
                       i  did  c  k                                p    d me    

        90       100       110       120       130       140       150       160
ralrptsqedkstqtlgrasteqgvmmscgvteepqrqfyqvamyslglwasspavaepa      lpaprsq-ygrtlq
p wyvgtelrsasnpsaprlpsivqglrvslrystlqiwrntrlprsrvvrppvrt          riiegl-sr-lqil
a rgselrcmhdehma lmhecesevaesracdpeaphrggpkghppp p agrlq          a   fiyqqskn  
   fr kk le  d    g a adde dap  a   efaeeneeek n a  f                 egediegg  
   ad    ed             a           a   a   aa                        aea d fd  

       170       180       190       200       210       220       230    
 dnpnplm-sveggvpnhqlfqftrnpfsltqrhnvwqkefvmqrppsag  g lg glk              
  m dliktqtatvqkldfh gesphg hhslnclcqli   flnflf                          
  l aegirimtrqliia g ecql a e rdlah  gg   cekdf                           
  e    dpfigeikea  f    k   d n   a  da    ca                             
        neecdagd              a                                           
© 1998-2022Legal notice