Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqpsdvssecdregrqlqpaerppqlrpgaptslq------------------------------tepq--p---hgg
-----------------mfsiprgeageqeesslaerllgpspagdrpsdsgkhhrqapgllldcsl--e-gn-egn---
    mepsrgvkelkndvpgvedfqrsalvdtlsyadgfaqltme                vwgaphsr-dltssthcc 
       mpckea  da s  rpas etemlgaaqt r edkl                     vtdqql af lsd a 
                       i  did  c  k                                p    d me    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-g-scphgspqgplapp---gpfatrsp----mrrssllsrs-s-------drspapmscd-----kstqtpsppcqafn
e-d--------------asp--------lfif----------s-gyfsfdt----------mrpei-----err-tdewr
ralrptsqedkstqtlgrasteqgvmmscgvteepqrqfyqvamyslglwasspavaepa      tplpa-q-yg-sqt
p wyvgtelrsasnpsaprlpsivqglrvslrystlqiwrnprlprsrvvrppvrt          rii rl-sr-rqlq
a rgselrcmhdehma lmhecesevaesracdpeaphrggnkghppp p agrlq          lea giyqqskni 
   fr kk le  d    g a adde dap  a   efaee  eek n a  f             a   fgtdiegg  
   ad    ed             a           a   a   aa                        eaa e fd  
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
hylsamasrrqaep-------r---------------------------------------------------
rvyrrfvakl----admrpei-iaqelrrigdefnayyarrlhlnnyqaledhpqmvilrllryivrlvwrmh
qssenl--g-tlsgtlsmriwlprttgqqysmrqssvwlllvfrlalrnasrgssapsr              
lrqavriv-fkelcgtqlwhrfhvsshhlvrrtlwlsttqfnsywwdnlegnrnhllpq              
dmplsqgdwvecavvsiqgfqespnqfthtqnhvvwqkefvmqspvsag  g lg glk              
aladpgtrtkrtvtpnhkf g rlcp saselahhqni   flnfpq                          
 k  e mpsilrqsiad   f  k g d ndh acclg   cekelf                          
 e    lnqefgmre     a  f a   f a    ga    cadf                           
        idddikd              a      d                                    
        faa g                                                            
        e                                                                
© 1998-2022Legal notice