Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         .      
-----------------mfqp-e-ep--qpgsslseq-------------------------------eeqltpsthhgg
makqpspvssveeregr----p-r--sl---------llgpspagdrpsdsgkhhrqapgllldcslt----nslsncrk
    medsrcecdl ddvlgiedgprqeredaptalrgfaqltme                vwgaphsrpdgm gkkac-
                 qs vapfs galmetlsyad  e                        vtdqql af egd-- 
                     r i  di                                       p    d me    
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .                  
pg-sspsrsqqgtqplgpa-tsqgvg-------------mpcgvterrssllsrvasgylslwad---------------
naqrpthqepkssltpp--sppfatrrgrgkkllssplalelfifmepqrqrynssyytfnfd--rspapptsrsqrqtr
e-lpceagadaapda-aaspgea--m             ss----lsvlvhflgprqsssgvvtstplvatipgpyspgl
- dyv tecrheln-s-rrl---sr-             vdvstrdqefqfkgenkmprqriprqpvatle  firqyek
r wfd l  medehma lmkaqidee               rplqap apdaeafclkppp i plfcsg   egdprcg
a  a     ed  e       ce d                aahe    ga     ghl e a kge p    aead  f
                        a                  a     a      eek      f        a    d
                                                         aa                     

       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
--r---------------------rscqkgtqtrsrqcsaflh-l-a-a-------------
ew-rvtevfvdgfkllppnimrhwmp-d-sqr-pmppsq----y-s-m-lwnlsrgssapsr
qlqnssatqmpsvttqcilhqgfr-hv-s---v---l-lvwnlffqyllvrlegnrnhllpq
li hrqrsgiararrgkead f ql-rtrhshssrt-w-sttrvclswwnng eg lg glk
g  dmpdr g q aga        ktpsq lanqnfvvwqkffq hnrghfe          
d   ll p                e lnp h kglearrli  l e f fcd          
    ea e                  kme   adia   gg    c   da           
                            a          ca                     
© 1998-2020Legal notice