Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5HZI5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5HZI5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQ-------------
A0A2K5KGP2_BMF-01       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5KGP2_BMF-02       ----MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS--------
A0A2K5J4Q7_BIK-01       -----------------MSGVRPISRDILMETLLYEQLLEPLTME-----
A0A2K5HKU7_BAD-02       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
A0A2K5HKU7_BAD-01       -----------------MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSD
                                                                          

A0A2K5JY17_PMAIP1-      ----------------------MPGKKARKNAQPSPARAQAELE------
A0A2K5JY17_PMAIP1-      ----------------------MPGKKARKNAQPSPARAQAGTDPLGPAK
A0A2K5HZI5_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5HZI5_BCL2L11      -----------------TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP
A0A2K5KGP2_BMF-01       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5KGP2_BMF-02       -----------LLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5J4Q7_BIK-01       -----------VLGVTDPEEDLDPMED------FDPLECMEDSDMLALRL
A0A2K5HKU7_BAD-02       SGKHHRQAPGLLWDASHQQEQATSSSHHGGRAWYSPSESEDSENPSARML
A0A2K5HKU7_BAD-01       SGKHHRQAPGLLWDASHQQEQATSSSHHGGAG-AVETRSRHSSHPAG---
                                               .                          

A0A2K5JY17_PMAIP1-      -------------------VECATQLRRFGDKLNFRQKLLNLIAKLFCSG
A0A2K5JY17_PMAIP1-      TQAGRGRGRGKKLLSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPA
A0A2K5HZI5_BCL2L11      GPFATR-------------SPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
A0A2K5HZI5_BCL2L11      GPFATR-------------SPLFIFMRRSSLLSRSSSGYFSFDTDRSPAP
A0A2K5KGP2_BMF-01       PSQGVM-------------LPCGVTEEPQRLFYAPAEPKSRVVADPPL--
A0A2K5KGP2_BMF-02       PSQGVM-------------LPCGVTEEPQRLFYGNAGYRLPLPASFPAVL
A0A2K5J4Q7_BIK-01       ACIGDE-------------MDVSLRAPRLAQLSEVAMHSLGLA-------
A0A2K5HKU7_BAD-02       TEASAG-------------MSAPATDSEAQHAENVKLEALGLWRPGVATA
A0A2K5HKU7_BAD-01       TEEDEG-------------ME----EEPSPFRGRSRSAPPNLW-------
                                                                 .        

A0A2K5JY17_PMAIP1-      T-------------------------------------------------
A0A2K5JY17_PMAIP1-      ETSESDSQTLLLRNLTAT----------------KTCMRGLQKRIFLRRC
A0A2K5HZI5_BCL2L11      ----------------------------------MSCDKSTQTPSPPCQA
A0A2K5HZI5_BCL2L11      ----------------------------------MSCDKSTQTPSPPCQA
A0A2K5KGP2_BMF-01       ----PAQPCFEWRREQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLV
A0A2K5KGP2_BMF-02       PI-GEQPPEGQWQHRAEVQIAR-KLQCIADQFHRLHVQQHQQNRNRVWWQ
A0A2K5J4Q7_BIK-01       ---FIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLL
A0A2K5HKU7_BAD-02       PTPRGRRRTKGWRRSPAPF--GAARAP-------RPLTSGQHSDMAASSG
A0A2K5HKU7_BAD-01       ---AAQRYGRELRRMSDEFVDSFKGLP-------RPKSAGTATQMRQSSS
                                                                          

A0A2K5JY17_PMAIP1-      ----------------------
A0A2K5JY17_PMAIP1-      TFHQFEARLHCN----------
A0A2K5HZI5_BCL2L11      FNHYLSAMANWD----------
A0A2K5HZI5_BCL2L11      FNHYLSAMGVFE----------
A0A2K5KGP2_BMF-01       KLFFCCYFAF------------
A0A2K5KGP2_BMF-02       ILLFLHNLALNGEENRNGAGPR
A0A2K5J4Q7_BIK-01       ALLLLLALLLALLSGGLHLLLK
A0A2K5HKU7_BAD-02       G---------------------
A0A2K5HKU7_BAD-01       WTRVFQSWWDRNLGRGSSAPSQ
                                              

© 1998-2020Legal notice