Dataset for protein Bim of organism Chrysemys picta bellii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            ********************************************************************
------------MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQG
mssyffagkkdq                                                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PFAPPSSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWES
                                                                                

       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************
PSVREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
                                                            
© 1998-2022Legal notice