Dataset for protein Bim of organism Chrysemys picta bellii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3FX85_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L11 (length=208 residues).
MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWESPSVREDMQPEIW
IAQELRRIGDEFNASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C3FX85_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L11 (length=220 residues).
MSSYFFAGKKDQMAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQG
PFAPPSSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWES
PSVREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIILRLLRYIIRLIWRLQ
© 1998-2022Legal notice