Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------evss-ae-------------------------lle----qpqptppgnhggsplsaplgspslsdcp
imfqvpemepsps---rs--rglrplqpgerppqlrphhrqapgl---ssvteeegnsssaqppg---sdpeerqgplaw
 ksgirsfakqeqdpt-evdqeggqslaadpqsdcgkg       ewtdlqq---dgee-hm--esdycshfaqgelets
     gpisrdtmqdplccsatwvlctmeg   s l         apdadhfs v--a-k-lq -gwrrqswvsedcaqq
       arac wme  ly  l e   ic                vagvtlpm gls-redfc tatqdgr pmvve nl
            c    a                              qhde  dkk m  aa c mh aa leah  md
                                                        d               c       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aarlglf--rsqlslrmrrtsqlsea--------------------------------g------------rspap-s-p
lssp---pttmpcgpnllpslledrsqqtlgpaspslgvmlpcgvttepqrlfyvrss-yfsfdtdimrfw-----m-l-
prkmqprllqhdafigasapatdqkvtrrmwvklrrqrltfrprqeepitpvvrspalywttlren     krrvvaacd
sleiadqaslacvtafvqylrrrgqt haenrrrkpsp awi dpadd rltllrntkpfr          hlcs rgwv
 g f cksrfrekl prpvk gcelh       mha     a     a adrg ggmg  g           k n qdpc
     aigneladd a ikg f  gg        a                   afhe              a l g fa
        da         e e   e                               d                f f a 
                   a                                                            

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
k--------pcqvwnl--ggl----------------------------------------------------
-stqtpspq-asllahys---tlrrlrcpadmrprlrvqqhqrrrnrvwwqyylrrlnlalngeqnrngpgpr
tywpwltapw--af--slslmssppqqrmpeqfhnihia elqnigdefnailaflhek     ee g a   
svprvgpsgrrv--rrrawaqprlnkhei   e e                                      
rhl p lq qhlqyqalvev iqilga a                                            
lae i el lggemp im   hifkf                                               
a     c  aef a  a    ga e                                                
                     a                                                   
© 1998-2020Legal notice