Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------makqpsdvsse------------------------cdr
msgvrpisrdtwmetllyeqlleplmepsrcvkfgvgsmfqcpefe-raqpasslsadlfaqslldcplsrlvlfql--c
                         tmevlgieeleddaraiedqvg-eaedtwvmlqicgprerhg rtpgqqcpiths
                                tdp e vdpp-c-- g----- dlca              g lsrlrm
                                      lc m -gr lgpmgv                       gagt
                                           lhd   c ed                         ep
                                                                              a 
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
egrqlqpa---erpp----------qlrpga--------ptslqtepq----gn-g------------------------
aepgarkslagdqasgalgsvlrpldcgkhhrqspgllwdcahtqgqpgnpe--h-gegdscphgspqgplaptpgrssa
ppkkrgvtsqeaklt          ptlaqtspaqpvml-agv-e--hrssshhgrpawywptwikelvssss       
cagrmtlnprpss a          smvgprmhrr rpfl---pdrt-tpfysfrlemqqplsregadsrrra       
s sp lar llqh v          rsthvc   l  aairdqg-dltsltrrvai gephfre    pepp        
r dl d p  apg e           pses         gqcgal irqvrpapqe   l aa     lanm        
q ae   e                  ah a         ak   g  addqn amd                        
i  a                                    g   a    ala                            
g                                                 a                             
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lalaggaapgvaraqrpggpggrshpggpgsprgggtvgpgdrgpaaadggrpqravraaetrgpaspgpfatrsplfif
                                                                aslveersrsvsvpat
                                                                tratatyelqrqyqsk
                                                                lgmnrqlghhmaea h
                                                                dd lpga eeg d  g
                                                                        a d a   
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------drspapmscdkstqtpsppcqafnh-----ylsamasr---------p-------------
mrrssllsrsssgyfsfdt------p-----r-rt---------aggrgwrr-----rqaepadmr-eiriaqelrrigd
tsedastqvvvlsrlgqyrsgvtrl-pvrrp-g--pnapdtlasrydye--ctlvvfieckaglplllssggltqmlfss
lqtpqhapnpqgpen lwlpplrttvdtfdggsesllwrvwyvthsqtslw-wpqalvtvirvsvewqfvrttvvqqqrn
hglae  eglk ka  aqklkcvvsywpvqrwrqra entvspqdl kqfvpssdeatgsalraswrpvlcrhs lpyqh
de               p gamqpervrqmqiwpqq clllael   glrqhretrwndrvvqeqkdnth qcq ihkee
                 g a feedftnilifp ae  ag   g   f imgnappslalrkpclaaklf nah haa c
                      a c eleea h      e          k m gnqe hlgl i  fge l g d    
                        a  a a                      l elpd gf d a    a f        
                                                    h ciia e                    
                                                    f   e  d                    

       330       340       350       360 
....:....|....:....|....:....|....:....|.
                                         
-----------------------------------------
efnayyarrvflnnyqlasehpqmvilrllryivrlvwrmh
slrvwwqsllskpllsasgdqsrngpgpr            
rwtrvtkqwnqwlpsrstetpn g a               
mnsqrqhlewlrhkgfgn see                   
khhinlei mhidfecc  a                     
hg fdf    eea da                         
g  ca     d   a                          
          a                              
                                         
                                         
© 1998-2022Legal notice