Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------makqpsdvsse-------cdre----------------
msgvrpisrdtwmetllyeqllepltmevlgikfgvgsmrqcp-fe-reqeatsvvlcqi--sarhgprtpggqlsgarr
                               vtdpeedafai-eqvg-ac-eswdmcqlrlpmp                
                                      ldpmec-- l-avd-  l aicggls                
                                       c   lmr  r-p-v        ecr                
                                           dhd  gpm d        atq                
                                                              pi                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gpgprrpaplparppgalgsvlrplrarpgcrprrprpaarclplrphrptrrhrrpggpplawgspqpaprptpgrssa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------grqlqpa---erppqlrpgaptsl---------qtepq----g-------------------p-a----
lalaggaapgvedgagkslagdglspcgkhsrqapgllwdashqdeqatsnpe-nhggegdscphgspqgpla-p-spgp
           dkvfrvegrlaqeadmqaqhslga  aficdqttlg--gsshhpgsrlqlfplthccgpgtratsleer
           askqtln passsvgavhvtm-e-         ggfvhvlrdcgllawyswswrsvrsvssstsmqtdk
           pgamlar   qhahsstesrlr v         -d-tgrplsfvriemeqrfteikellrrmgrdvntq
            ar d p   p  e ps a gk g         a-trdqgqr mqa d gpar agdaenp  l parg
             l   g   g    gh   eh            qilapddp fd  a  h q  ea ae   g a pa
             e                  g            a    aan aa                  d   a 
                                                    a                     a     
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------drspapmscdkstqtpsppcqafnhylsamasrrqa---------------
fatrsplfifmrrssllsrsssgyfsfdt---tr-v--rrrrrr-------l---gyglcrm---epadmrglprplssg
sersvqvattsedqhatvvvqkplgqwrpgqt--t-pvsqggmstpgvtet-qsl-rlwvtpplelvdsspavlliptvp
arsqrypqslqltpa pqlpl ernlgqltvcllrtdp-gfwglrnlwpvlparifkf-rlfeevaavtflrsvpaklq 
yhlmgde khhgae  engkg a  ga  kmregcawfqd-v--llfrrdeyplawd-r---tdpvtplak a   gea 
r heaaa gde  a               alervayttm-q-sqacanqw vgtds-wppvysstfsngpa         
l ed                          faqe sqrepishk e llk se  mqtnlnwngrrglel          
g                             a  c enlaeape  a aag a   apsfkislahi gck          
                                     i    d             ge ggik d   ac          
                                                            ehi                 
                                                            cgd                 
                                                            aea                 
                                                             a                  

       330       340       350       360       370       380    
....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                
----------------------------------------------------------------
gltqmrqrpeiriaqelrrigdefnayyarrvflnnyqaaedhpqmvilrllryivrlvwrmhr
thsvwqkssggqrvlqwwwytnhhrevtwqlnwkpsssvwwqillflhnla ngeenrngagp 
qehllphlrsatprfksqlerlrgsrssvpslsqlrnrst                        
pag ilfwlpwlkntg dcdqhqqhqlrlhqqqedpd                           
     aapwnvf frf   cael gpeqe cmh ala                           
       icms  c          fgdh   he  f                            
       eall                    ec                               
         i                      a                               
         f                                                      
                                                                
                                                                
                                                                
© 1998-2022Legal notice