Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       ------------MEPSRCVE-------------------------ELEDD
A0A2K5MJW4_BMF-02       ------------MEPSRCVE-------------------------ELEDD
A0A2K5P2T8_BBC3-03      IKFGVGSARACPCQVPRAASATWVLCQICGPQPSLL---------LAEQH
A0A2K5NU92_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPG-------APTSL
A0A2K5NU92_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPG-------APTSL
A0A2K5LDM6_BIK-01       -MSGVRPISRDTWMETLLYEQLLEPLTME----------------VLGVT
A0A2K5M0A7_BAD-03       -MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDAS
A0A2K5M0A7_BAD-02       -MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDAS
                                                                          

A0A2K5NJZ2_PMAIP1-      --MPGKKARKNAQPSPMRAQAELEVECATQLRRFGDKLNFRQKLLNLIAK
A0A2K5KZ69_HRK-01       -----------MCPCPLHRGRGPPAVCDCSAGRLGLRSSAAQLTAARLKA
A0A2K5MJW4_BMF-01       VFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K5MJW4_BMF-02       VFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K5P2T8_BBC3-03      LESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYE
A0A2K5NU92_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2K5NU92_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2K5LDM6_BIK-01       DPEEDLDPMEDF------DPLECMEDSDMLALRLACIGDEMDVSLRAPRL
A0A2K5M0A7_BAD-03       HQQEQPTSSSHHGGGAWYSPSWESEDSENPSARM-----LAEASARMSAP
A0A2K5M0A7_BAD-02       HQQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QLDASLPVLVG
                                                                          

A0A2K5NJZ2_PMAIP1-      LFCSGT--------------------------------------------
A0A2K5KZ69_HRK-01       LGDELHQRTMWRRRARSR--------------------------------
A0A2K5MJW4_BMF-01       SQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEP-----------
A0A2K5MJW4_BMF-02       SQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGY-----------
A0A2K5P2T8_BBC3-03      RRRQEEQQR-----------------------------------------
A0A2K5NU92_BCL2L11      SLLSRS------------------------------SSGYFSFDTD----
A0A2K5NU92_BCL2L11      SLLSRS------------------------------SSGYFSFDTD----
A0A2K5LDM6_BIK-01       AQLSEV------AMHSLGLAFICDQTDDIRDVLRSFMDGFTTLRENIMRF
A0A2K5M0A7_BAD-03       ATDSEAQHAENVKLKALGL-WRPGVATAPTPRGRRRTKGWR---------
A0A2K5M0A7_BAD-02       SELGQG------KLRPLPVTFAPRPETPPALTVLVGHLGYG---------
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5KZ69_HRK-01       -RAPAPGALPTYWPWLCA-AAQVAALAAWLLSRRNL--------------
A0A2K5MJW4_BMF-01       -KSRVVADPPL-----PAQPCFEWRR------------------------
A0A2K5MJW4_BMF-02       -RLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQ
A0A2K5P2T8_BBC3-03      -HRPSP-------------WRVLYNLIMGLLPLPRGHRAPEMEPN-----
A0A2K5NU92_BCL2L11      -RSPAPMSCDKSTQTPSP-PCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
A0A2K5NU92_BCL2L11      -RSPAPMSCDKSTQTPSP-PCQAFNHYLSAMGIFE---------------
A0A2K5LDM6_BIK-01       WRSPNPRSWVSHEQVLLL-LALLLALLSGGLHLLLK--------------
A0A2K5M0A7_BAD-03       -RSPAPFGAARAPRPPTSGQHSVMAASSGG--------------------
A0A2K5M0A7_BAD-02       -RKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM-----------
                                                                          

A0A2K5NJZ2_PMAIP1-      ---------------------------------
A0A2K5KZ69_HRK-01       ---------------------------------
A0A2K5MJW4_BMF-01       -----------------------EQERGGP---
A0A2K5MJW4_BMF-02       HQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K5P2T8_BBC3-03      ---------------------------------
A0A2K5NU92_BCL2L11      ELRRIGDEFNAYYARRLEK--------------
A0A2K5NU92_BCL2L11      ---------------------------------
A0A2K5LDM6_BIK-01       ---------------------------------
A0A2K5M0A7_BAD-03       ---------------------------------
A0A2K5M0A7_BAD-02       ---------------------------------
                                                         

© 1998-2020Legal notice