Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5P2T8_BBC3-02      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5P2T8_BBC3-03      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5KZ69_HRK-01       --------------------------------------MCPCPLHRGRGP
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5MJW4_BMF-01       -------------------------MEPSRCVEELEDDVFQPEDGEPGAQ
A0A2K5MJW4_BMF-02       -------------------------MEPSRCVEELEDDVFQPEDGEPGAQ
A0A2K5LDM6_BIK-01       MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K5M0A7_BAD-03       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0A7_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0A7_BAD-02       --------------------------------------MFQIPEFEPSEQ
                                                                          

A0A2K5NJZ2_PMAIP1-      -----------------------------MPGKKARKN---AQPS-----
A0A2K5P2T8_BBC3-01      SATWVLCQICGPRERHGPRTPGGQLSGARRGPGPRRPAPLPARPPGALGS
A0A2K5P2T8_BBC3-02      SATW------------------VLCQICETRGAAATPPLALEGPV-----
A0A2K5P2T8_BBC3-03      SATW------------------VLCQICGPQPSLLLAE---QHLE-----
A0A2K5KZ69_HRK-01       PAV------------------------CDCSAGRLGLR---SSAA-----
A0A2K5NJZ2_PMAIP1-      -----------------------------MPGKKARKN---AQPS-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5NTQ5_BCL2L11      SSE------------------------CDREGRQLQPA---ERPP-----
A0A2K5MJW4_BMF-01       PGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT-----
A0A2K5MJW4_BMF-02       PGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT-----
A0A2K5LDM6_BIK-01       MEDSDMLAL-----------------RLACIGDEMDVSLRAPRLA-----
A0A2K5M0A7_BAD-03       EDSS-------------------------SAERGLGPSLAGDRPS-----
A0A2K5M0A7_BAD-01       EDSS-------------------------SAERGLGPSLAGDRPS-----
A0A2K5M0A7_BAD-02       EDSS-------------------------SAERGLGPSLAGDRPS-----
                                                                          

A0A2K5NJZ2_PMAIP1-      -----PMRAQA---------------------------------------
A0A2K5P2T8_BBC3-01      VLRPLRARPGCRPRRPRPAARCLPLRPHRPTRRHRRPGGPPLAWGSPQPA
A0A2K5P2T8_BBC3-02      -----QSHHGT--------P-ALTQGPQSPRNGAQLGA------------
A0A2K5P2T8_BBC3-03      -----SPVPSA--------PGALAGGPTQAAPGVRGEEEQWAREIGAQLR
A0A2K5KZ69_HRK-01       -----QLTAAR--------LKALGDELH----------------------
A0A2K5NJZ2_PMAIP1-      -----PMRAQA--------GQAGTAGTARDQAGFGIGMQLHFTRGKELVS
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQ----------------------
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQ----------------------
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQ----------------------
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQ----------------------
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5NTQ5_BCL2L11      -----QLRPGA--------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGP
A0A2K5MJW4_BMF-01       -----QTLGPASPSQGVMLPCGVTEEPQRLFYAPAE--------------
A0A2K5MJW4_BMF-02       -----QTLGPASPSQGVMLPCGVTEEPQRLFYGNAG--------------
A0A2K5LDM6_BIK-01       -----QLSEVAMHSLGLAFICDQTDDIRDVLRSFMD--------------
A0A2K5M0A7_BAD-03       -----DCGKHHRQAPGLLWDASHQQEQPTSSSHHGGGAWYSPSWESEDSE
A0A2K5M0A7_BAD-01       -----DCGKHHRQAPGLLWDASHQQEQPTSSSHHGG--------------
A0A2K5M0A7_BAD-02       -----DCGKHHRQAPGLLWDASHQQEQPTSSSHHGG--------------
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      PRPTPGRSSALALAGGAAPGVARAQRPGGPGGRSHPGGPGSPRGGGTVGP
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K5P2T8_BBC3-03      RMA-----------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      SSP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5NTQ5_BCL2L11      LAP-----------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       NPS-----------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      GDRGPAAADGGRPQRAVRAAETRGAAATPPLALEGPVQSHHGTPALTQGP
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K5P2T8_BBC3-03      ------------------------DDLNAQYERRRQE-------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      ------------------------LALPRGREEQVQV-------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5NTQ5_BCL2L11      ------------------------PASPGPFATRSPLFIFMRRSSLLSRS
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       ------------------------ARMLAEASARMSAPATDSEAQHAENV
A0A2K5M0A7_BAD-01       ------------------------AGAVETRSRHSSYPAGTEEDE-----
A0A2K5M0A7_BAD-02       ------------------------TSSPEERGHSDADAAKLQLDASLPVL
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      QSPRNGAQLGACTRPVDVRDSGGRPLPPPDTLASAGD--FLCTM------
A0A2K5P2T8_BBC3-02      -----------CTRPVDVRDSGGRPLPPPDTLASAGD--FLCTM------
A0A2K5P2T8_BBC3-03      ------------------EQQRHRPSPWRVLYNL-----IMGLLPLPRGH
A0A2K5KZ69_HRK-01       ------------QRTMWRRRARSRRAPAPGALPT-----YWPWLCAAAQV
A0A2K5NJZ2_PMAIP1-      ---------ARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTASNTC
A0A2K5NTQ5_BCL2L11      --------------------------------------------ASRRQA
A0A2K5NTQ5_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMDEAT--
A0A2K5NTQ5_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMVVILED
A0A2K5NTQ5_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASRRQA
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMVREIEE
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMANWD--
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMGIFE--
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASRRQA
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASRRQA
A0A2K5NTQ5_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH-----YLSAMASRRQA
A0A2K5MJW4_BMF-01       -------PKSRVVADPPL-----PAQPC---------FEWRR--------
A0A2K5MJW4_BMF-02       -------YRLPLPASFPAVLPIGEQPPE---------GQWQHRAEVQIAR
A0A2K5LDM6_BIK-01       ----------GFTTLRENIMRFWRSPNP---------RSWVSHEQVL--L
A0A2K5M0A7_BAD-03       KLKALGLWRPGVATAPTP-RGRRRT------------KGWRRSPAPF--G
A0A2K5M0A7_BAD-01       ----------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDS
A0A2K5M0A7_BAD-02       VGSELGQG--KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQAL--C
                                                                          

A0A2K5NJZ2_PMAIP1-      -----ELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT----------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K5P2T8_BBC3-03      RAPEMEPN------------------------------------------
A0A2K5KZ69_HRK-01       AALAAWLLSRRNL-------------------------------------
A0A2K5NJZ2_PMAIP1-      IRGLQKRLFLRRCTLHQFEERLHCNW------------------------
A0A2K5NTQ5_BCL2L11      EPADMRPEIRIAQELRRIGDEFNAYYARRLAELLASST------------
A0A2K5NTQ5_BCL2L11      ------------------GSSLRIALHREVQWPLECLASS----------
A0A2K5NTQ5_BCL2L11      IGDSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------------
A0A2K5NTQ5_BCL2L11      EPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLL
A0A2K5NTQ5_BCL2L11      VVV-----------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      EPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLL
A0A2K5NTQ5_BCL2L11      EPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD---------------
A0A2K5NTQ5_BCL2L11      EPADMRPEIRIAQELRRIGDEFNAYYARRLEK------------------
A0A2K5MJW4_BMF-01       ---------------------------------------EQERGGP----
A0A2K5MJW4_BMF-02       KLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR-
A0A2K5LDM6_BIK-01       LLALLLALLSGGLHLLLK--------------------------------
A0A2K5M0A7_BAD-03       AARAPRPPTSGQHSVMAASSGG----------------------------
A0A2K5M0A7_BAD-01       FKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------
A0A2K5M0A7_BAD-02       KRGSVLPLSVGGLTQIPFRCM-----------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      -----------
A0A2K5P2T8_BBC3-01      -----------
A0A2K5P2T8_BBC3-02      -----------
A0A2K5P2T8_BBC3-03      -----------
A0A2K5KZ69_HRK-01       -----------
A0A2K5NJZ2_PMAIP1-      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      RYIVRLVWRMH
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      RYIVRLVWRMH
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5NTQ5_BCL2L11      -----------
A0A2K5MJW4_BMF-01       -----------
A0A2K5MJW4_BMF-02       -----------
A0A2K5LDM6_BIK-01       -----------
A0A2K5M0A7_BAD-03       -----------
A0A2K5M0A7_BAD-01       -----------
A0A2K5M0A7_BAD-02       -----------
                                   

© 1998-2022Legal notice