Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5LDM6_BIK-01       MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K5M0A7_BAD-03       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0A7_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0A7_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K5MJW4_BMF-02       --------------------------------------------MEPSRC
A0A2K5MJW4_BMF-01       --------------------------------------------MEPSRC
A0A2K5P2T8_BBC3-02      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5P2T8_BBC3-03      -------------------------------IKFGVGSARACPCQVPRAA
A0A2K5KZ69_HRK-01       --------------------------------------MCPCPLHRGRGP
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NTQ5_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A2K5NJZ2_PMAIP1-      ------------MP------------------------------------
A0A2K5P2T8_BBC3-01      SATWVLCQICGPRERHGPRTPGGQLSGARRGPGPRRPAPLPARPPGALGS
A0A2K5LDM6_BIK-01       MEDSDMLALRLACI------------------------------------
A0A2K5M0A7_BAD-03       EDSS--------SA------------------------------------
A0A2K5M0A7_BAD-01       EDSS--------SA------------------------------------
A0A2K5M0A7_BAD-02       EDSS--------SA------------------------------------
A0A2K5MJW4_BMF-02       VEE---------LE------------------------------------
A0A2K5MJW4_BMF-01       VEE---------LE------------------------------------
A0A2K5P2T8_BBC3-02      SATW-VLCQICETR------------------------------------
A0A2K5P2T8_BBC3-03      SATW-VLCQICGPQ------------------------------------
A0A2K5KZ69_HRK-01       PAV-------CDCS------------------------------------
A0A2K5NJZ2_PMAIP1-      ------------MP------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
A0A2K5NTQ5_BCL2L11      SSE-------CDRE------------------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      VLRPLRARPGCRPRRPRPAARCLPLRPHRPTRRHRRPGGPPLAWGSPQPA
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ---------------------GKKARKN---AQPSPMRAQAELEV-----
A0A2K5P2T8_BBC3-01      PRPTPGRSSALALAGGAAPGVARAQRPGGPGGRSHPGGPGSPRG------
A0A2K5LDM6_BIK-01       ---------------------GDEMDVSLRAPRLAQLSEVAMHSLGLAFI
A0A2K5M0A7_BAD-03       ---------------------ERGLGPSLAGDRPSDCGKHHRQAPGLLWD
A0A2K5M0A7_BAD-01       ---------------------ERGLGPSLAGDRPSDCGKHHRQAPGLLWD
A0A2K5M0A7_BAD-02       ---------------------ERGLGPSLAGDRPSDCGKHHRQAPGLLWD
A0A2K5MJW4_BMF-02       ---------------------DDVFQPE---DGEPGAQPGSSLSA-----
A0A2K5MJW4_BMF-01       ---------------------DDVFQPE---DGEPGAQPGSSLSA-----
A0A2K5P2T8_BBC3-02      ---------------------GAAATPPLALEGPVQSHHGTP-AL-----
A0A2K5P2T8_BBC3-03      ---------------------PSLLLAE---QHLESPVPSAPGAL-----
A0A2K5KZ69_HRK-01       ---------------------AGRLGLR---SSAAQLTAARLKAL-----
A0A2K5NJZ2_PMAIP1-      ---------------------GKKARKN---AQPSPMRAQAGQAG-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
A0A2K5NTQ5_BCL2L11      ---------------------GRQLQPA---ERPPQLRPGAPTSL-----
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-01      ----GGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLALEGPVQSH
A0A2K5LDM6_BIK-01       CDQTDDIRDVLRSFMD----------------------------------
A0A2K5M0A7_BAD-03       ASHQQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATD
A0A2K5M0A7_BAD-01       ASHQQEQPTSSSHHGG-----------------AGAVETRSRHSSYPAGT
A0A2K5M0A7_BAD-02       ASHQQEQPTSSSHHGG-----------------TSSPEERGHSDADAAKL
A0A2K5MJW4_BMF-02       ----DLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKA---------
A0A2K5MJW4_BMF-01       ----DLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKA---------
A0A2K5P2T8_BBC3-02      ----TQGPQSPRNGAQLGA-------------------------------
A0A2K5P2T8_BBC3-03      ----AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---
A0A2K5KZ69_HRK-01       ----GDELH-----------------------------------------
A0A2K5NJZ2_PMAIP1-      ----TAGTARDQAGFGIGMQLHFTRGKELVSSSPLALPRGREEQVQV---
A0A2K5NTQ5_BCL2L11      ----QTEPQ-----------------------------------------
A0A2K5NTQ5_BCL2L11      ----QTEPQ-----------------------------------------
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIF
A0A2K5NTQ5_BCL2L11      ----QTEPQ-----------------------------------------
A0A2K5NTQ5_BCL2L11      ----QTEPQ-----------------------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ----------------------ECATQLRRFGDKLNFRQKLLNLIAKLFC
A0A2K5P2T8_BBC3-01      HGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLC
A0A2K5LDM6_BIK-01       -------------------GFTTLRENIMRFWRSPNP---------RSWV
A0A2K5M0A7_BAD-03       SEAQHAENVKLKALGLWRPGVATAPTP-RGRRRT------------KGWR
A0A2K5M0A7_BAD-01       EEDE---------------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELR
A0A2K5M0A7_BAD-02       QLDASLPVLVGSELGQG--KLRPLPVTFAPRPETPPALTVLVGHLGYGRK
A0A2K5MJW4_BMF-02       -------------------TQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K5MJW4_BMF-01       -------------------TQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A2K5P2T8_BBC3-02      ---------------------CTRPVDVRDSGGRPLPPPDTLASAGDFLC
A0A2K5P2T8_BBC3-03      ----------------------------EQQRHRPSPWRVLYNLIMGLLP
A0A2K5KZ69_HRK-01       ----------------------QRTMWRRRARSRRAPAPGALPTYWPWLC
A0A2K5NJZ2_PMAIP1-      -------------------ARSRVCYSTQEIWRQTELPAETSESDSQTLL
A0A2K5NTQ5_BCL2L11      -------------------------------------------------A
A0A2K5NTQ5_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMV
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMG
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K5NTQ5_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K5NTQ5_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMV
A0A2K5NTQ5_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-
                                                                          

A0A2K5NJZ2_PMAIP1-      SGT-----------------------------------------------
A0A2K5P2T8_BBC3-01      TM------------------------------------------------
A0A2K5LDM6_BIK-01       SHEQVL--LLLALLLALLSGGLHLLLK-----------------------
A0A2K5M0A7_BAD-03       RSPAPF--GAARAPRPPTSGQHSVMAASSGG-------------------
A0A2K5M0A7_BAD-01       RMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
A0A2K5M0A7_BAD-02       CFPQAL--CKRGSVLPLSVGGLTQIPFRCM--------------------
A0A2K5MJW4_BMF-02       GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K5MJW4_BMF-01       EPKSRVVADP-----------------PLPAQPCFEWRREQERGGP----
A0A2K5P2T8_BBC3-02      TM------------------------------------------------
A0A2K5P2T8_BBC3-03      LPRGHRAPEM-----------------EPN--------------------
A0A2K5KZ69_HRK-01       AAAQVAALAA-----------------WLLSRRNL---------------
A0A2K5NJZ2_PMAIP1-      LRNLTASNTC-----------------IRGLQKRLFLRRCTLHQFEERLH
A0A2K5NTQ5_BCL2L11      SRRQAEPADM-----------------RPEIRIAQELRRIGDEFNAYYAR
A0A2K5NTQ5_BCL2L11      SRRQAEPADM-----------------RPEIRIAQELRRIGDEFNAYYAR
A0A2K5NTQ5_BCL2L11      REIEEVVV------------------------------------------
A0A2K5NTQ5_BCL2L11      NWD-----------------------------------------------
A0A2K5NTQ5_BCL2L11      IFE-----------------------------------------------
A0A2K5NTQ5_BCL2L11      SRRQAEPADM-----------------RPEIRIAQELRRIGDEFNAYYAR
A0A2K5NTQ5_BCL2L11      SRRQAEPADM-----------------RPEIRIAQELRRIGDEFNAYYAR
A0A2K5NTQ5_BCL2L11      SRRQAEPADM-----------------RPEIRIAQELRRIGDEFNAYYAR
A0A2K5NTQ5_BCL2L11      VILEDIGDSS-----------------LWFGFIFTGLDLYGHHHSQDTEQ
A0A2K5NTQ5_BCL2L11      ---DEATGSS-----------------LRIAL-----------HREVQWP
                                                                          

A0A2K5NJZ2_PMAIP1-      ----------------------------------
A0A2K5P2T8_BBC3-01      ----------------------------------
A0A2K5LDM6_BIK-01       ----------------------------------
A0A2K5M0A7_BAD-03       ----------------------------------
A0A2K5M0A7_BAD-01       SQ--------------------------------
A0A2K5M0A7_BAD-02       ----------------------------------
A0A2K5MJW4_BMF-02       QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K5MJW4_BMF-01       ----------------------------------
A0A2K5P2T8_BBC3-02      ----------------------------------
A0A2K5P2T8_BBC3-03      ----------------------------------
A0A2K5KZ69_HRK-01       ----------------------------------
A0A2K5NJZ2_PMAIP1-      CNW-------------------------------
A0A2K5NTQ5_BCL2L11      RLAELLASST------------------------
A0A2K5NTQ5_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-
A0A2K5NTQ5_BCL2L11      ----------------------------------
A0A2K5NTQ5_BCL2L11      ----------------------------------
A0A2K5NTQ5_BCL2L11      ----------------------------------
A0A2K5NTQ5_BCL2L11      RVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-
A0A2K5NTQ5_BCL2L11      RLEK------------------------------
A0A2K5NTQ5_BCL2L11      RMSLPPD---------------------------
A0A2K5NTQ5_BCL2L11      LNHKDFS---------------------------
A0A2K5NTQ5_BCL2L11      LECLASS---------------------------
                                                          

© 1998-2022Legal notice