Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
:      .   : .*  .                   :   * .   *  :               .  .  :       
trmpataghrmada klqlaeslpvvvlse--qwrpkmepe tt-ap resp-pntwlvqry-rerkcmsdelvdgfkrl
 gal    ahd a  gde  ahaenlkgka  lg   laea s      a allvaaghl k l  f aa   caa a

       170       180       190         
  * : *  : :   .                       
vl lts qhsvipfrcmwtrvfqswwdrnlgrgssapsq
   k a ga   aa  gg                     
© 1998-2022Legal notice