Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5M0A7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5M0A7_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5M0A7_BAD-03      QQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
A0A2K5M0A7_BAD-02      QQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
                       *************    *.. *   *:  :*.:  :**  : . :  .:.

A0A2K5M0A7_BAD-03      QHAENVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPP
A0A2K5M0A7_BAD-02      ------KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCK-----
                             **..* : : *   *.*:        *: *.  * . ..     

A0A2K5M0A7_BAD-03      TSGQHSVMAASSGG---------
A0A2K5M0A7_BAD-02      ---RGSVLPLSVGGLTQIPFRCM
                          . **:. * **         

© 1998-2020Legal notice