Dataset for protein classical BH3-containing proteins of organism Cebus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------makqpsdvssecdregrqlqpaerpp------qlr------------------------
mseerplmkcgvgsmwqcpeq--r-sqegwvpaemglnrstagdselgsgkhrrqagpgprrpaplparppgalgrvlrp
       sidilmeafaiechvppseess-csgqlceppfslspgtahlelpvgtq                        
              tlp  qffe-am-p-q-vesksddvprhesaaqegqgns---                        
               cl  l rg l-p- vm- kdprtsgg vlp  acme gssv                        
                      d gtma  gg acaakded rad        drt                        
                                     g aa            apl                        
                                     e                ah                        
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------pga-------ptslqt
lrvrparrpcrprlaarclplrprhptrrhrrpgepplawgppqppprpapgrssalalaggaaa-lllsadlflgdasd
                                                                -ssaraqrpgaqailh
                                                                hl-       gaggav
                                                                 av        -c rs
                                                                  t        p  gq
                                                                  r        k  eg
                                                                  q             
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
epqgnpegnhgge--------------------------------------p------------r--s-------drspa
qqg----------cggpglrptsqegdscphgspqgplappaspgpfatrs-lfifvrrssvls-ss-gyfsfdt-f-t-
gmlqplsssplthvcsvrtlsrtssdkatqtldeasesqgvmllcgvtlepqvlfyaqtpqrsrvvlgpplvrqlg-q-v
cltsrtrlfrheanppgerg khrdytrstrtvsraqttesvaryrlreyr rvavtpagygrqlpapwrvqlpattcrs
hchvsrqrrq aqa aadm  aaaa p p eeergmhhrantkkrqsgswh gqwtsnlytqwpgtq vqdgim rsvnq
  dtqglpvk  g             m g aa  e  en d fape dmsg n vhhldqplildrm fiadaf nqrep
  a aadaag                g           e a   ea  aa    sggg egkei ek d      eemdm
                                                       ade  ed a  i a      cdl h
                                                            a              aaa d
                                                                               c
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pmscdkstqtps--ptc-qafnhylsama---------------------------------------------------
qvr--r-repgtwvgrklavl-dfgc---smrqsqaepagmrpeiwiaqelrrigdefnayyprrvflnnyqaaedhphm
--grr-rksqeipradawssal-w-rtlldwfsrglglglrwqvqlrvvwfassteqnrnkags lskpsd         
wy-lpwg-ra-ahp-stqrg-gsltaligafargavaslvwtnspfplln sqns  lhhg fl ie             
vrqwwhqm--q-  wipm--yar-s-vfvvyypqvtwrrmspell fckl  lg                          
sqevvgpltv w  s--eptsypqinqasrvwhmsrvqe la i    h   k                           
fpdfsdagps q  l q nqrwnifmg qqttglrnsn  k       e                               
ekaeqa ehr p       fqrkh he npqseknfri  e                                       
dg de  agl l       eiqg  d  hklqdeh l                                           
 f aa              ch a     diipc c h                                           
                             eeia                                               
                              ae                                                

       330       
....:....|....:..
                 
-----------------
vilrllryivrlvwrmh
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
© 1998-2021Legal notice