Dataset for protein classical BH3-containing proteins of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5QQC6_PMAIP1-      ------------------------------MPGKKARKSAQPSPAPA---
A0A2K5QNS7_BBC3-01      -------MKCGVGSAWACPCQVPRASSSVWVPCQMCGPRERHGPRTPGGQ
A0A2K5RN49_BMF-02       -------------------------MEPSQCVEELEDDVFQPEDGEP---
A0A2K5RN49_BMF-01       -------------------------MEPSQCVEELEDDVFQPEDGEP---
A0A2K5QXZ1_BIK-01       MSEERPLSIDILMETLLCEQFMDPLTMEVVGGGSDPEEDLDPVEDPLECM
A0A2K5QNS7_BBC3-02      -------MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLE
A0A2K5QNS7_BBC3-03      -------MKCGVGSAWACPCQVPRASSSVWVPCQMCETRGAAAAPPLALE
A0A2K5PDB1_BAD-01       --------------MFQIPE-FEPSEQEGSSSAERGLNPSTAGDSPPGSG
A0A2K5PDB1_BAD-02       --------------MFQIPE-FEPSEQEGSSSAERGLNPSTAGDSPPGSG
A0A2K5PDB1_BAD-03       --------------MFQIPE-FEPSEQEGSSSAERGLNPSTAGDSPPGSG
A0A2K5PIE7_HRK-01       --------------MCPCPLHRGRGPPAV---CACSAGRLGLRSSAA---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
A0A2K5Q1U2_BCL2L11      ---------------------MAKQPSDVSSECDREGRQLQPAERPP---
                                                                          

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5QNS7_BBC3-01      LPGARRGPGPRRPAPLPARPPGALGRVLRPLRVRPARRPCRPRLAARCLP
A0A2K5RN49_BMF-02       ---GTQ--------------------------------------------
A0A2K5RN49_BMF-01       ---GTQ--------------------------------------------
A0A2K5QXZ1_BIK-01       ENSDAL--------------------------------------------
A0A2K5QNS7_BBC3-02      ---SPV--------------------------------------------
A0A2K5QNS7_BBC3-03      GPVQSH--------------------------------------------
A0A2K5PDB1_BAD-01       KHRRQA--------------------------------------------
A0A2K5PDB1_BAD-02       KHRRQA--------------------------------------------
A0A2K5PDB1_BAD-03       KHRRQA--------------------------------------------
A0A2K5PIE7_HRK-01       ---QLT--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
A0A2K5Q1U2_BCL2L11      ---QLR--------------------------------------------
                                                                          

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5QNS7_BBC3-01      LRPRHPTRRHRRPGEPPLAWGPPQPPPRPAPGRSSALALAGGAAPGVARA
A0A2K5RN49_BMF-02       --------------------------------------------PGSLLS
A0A2K5RN49_BMF-01       --------------------------------------------PGSLLS
A0A2K5QXZ1_BIK-01       --------------------------------------------ALQ---
A0A2K5QNS7_BBC3-02      --------------------------------------------PSA---
A0A2K5QNS7_BBC3-03      --------------------------------------------HGT---
A0A2K5PDB1_BAD-01       --------------------------------------------PGL---
A0A2K5PDB1_BAD-02       --------------------------------------------PGL---
A0A2K5PDB1_BAD-03       --------------------------------------------PGL---
A0A2K5PIE7_HRK-01       --------------------------------------------AAR---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
A0A2K5Q1U2_BCL2L11      --------------------------------------------PGA---
                                                                          

A0A2K5QQC6_PMAIP1-      ----PADLEVECATQLRRF-------------------------------
A0A2K5QNS7_BBC3-01      QRPGGPGGRSHPGGPGSPRGGGAVGPGDRGPAAADGGRPQRAVRAAETRG
A0A2K5RN49_BMF-02       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
A0A2K5RN49_BMF-01       ADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
A0A2K5QXZ1_BIK-01       ----LACIADQMDVSLRARKLAQ---------------------------
A0A2K5QNS7_BBC3-02      ----PGALAGGPTQAALGVRGEE---------------------------
A0A2K5QNS7_BBC3-03      ----P-ALSQGPQSPRDGAQLGA---------------------------
A0A2K5PDB1_BAD-01       ----PGDASHQQGQPTSSSHHGGAGAVETRSRHRSYPAGTEEDEGMEEEP
A0A2K5PDB1_BAD-02       ----PGDASHQQGQPTSSSHHG-------------GTSSP--EERGHSNA
A0A2K5PDB1_BAD-03       ----PGDASHQQGQPTSSSHHGENPSARMLSKTSAGMSSPATDSEAQHTE
A0A2K5PIE7_HRK-01       ----LKALGDELH-------------------------------------
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQGNPEGNHGGE------------GDSCPHGSPQGPLAP
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQ-------------------------------------
A0A2K5Q1U2_BCL2L11      ----PTSLQTEPQ-------------------------------------
                                                                          

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5QNS7_BBC3-01      AAAAPPLALEGPVQSHHGTPALSQGPQSPRDGAQLGACTCPVDVRDSGGR
A0A2K5RN49_BMF-02       VMLPCGVTEEPQRLFYAPAEPKSRVVAGPPL-------PAQPGFEWRREQ
A0A2K5RN49_BMF-01       VMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEV
A0A2K5QXZ1_BIK-01       ---LYEVAMYSPGLAVTLDQTDIRDVLGGIVDIFANFQEDVVRLWRSLSS
A0A2K5QNS7_BBC3-02      --------------------EQWAREIGAQLQRMADDLNAQYERRRQEEQ
A0A2K5QNS7_BBC3-03      -----------------------------------CTCPVDVRDSGGRPL
A0A2K5PDB1_BAD-01       STFRGRSRSAPPNLWAAQRYGRELRRMSD------EFVDSFKGLPRPKSA
A0A2K5PDB1_BAD-02       DAAKRQLDASHPVLVGSELGQGRIRSLPV------TFAPHP------KTP
A0A2K5PDB1_BAD-03       NVKLEALGLWRPGVATDRTPQGRRRTKGW------RRSPAPFGAVRARHP
A0A2K5PIE7_HRK-01       ------------------------------------QRTMWRRRARSRRA
A0A2K5Q1U2_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      PASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      -----------------------------------ASMRQSQAEPAGMRP
A0A2K5Q1U2_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
A0A2K5Q1U2_BCL2L11      -----------------------------------DRSPAPMSCDKSTQT
                                                                          

A0A2K5QQC6_PMAIP1-      ----GDKLNFRQKLLNLISKLFCSGT------------------------
A0A2K5QNS7_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------------
A0A2K5RN49_BMF-02       EW--GRPE------------------------------------------
A0A2K5RN49_BMF-01       QI--ARKLQCIADQFHQLHVQQHQQNRNRVWWQVLLFLHNLALNGEENRN
A0A2K5QXZ1_BIK-01       GSWVSRKQAVLLAFLALLLATFSGGLHLLLK-------------------
A0A2K5QNS7_BBC3-02      PQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN-----------------
A0A2K5QNS7_BBC3-03      PP--PDTLASAGDFLCTM--------------------------------
A0A2K5PDB1_BAD-01       GT--ATQMRQSASWTRVIQSWWDRNLGRGGSAPSQ---------------
A0A2K5PDB1_BAD-02       PA--LIALSGHLGYGR-------KCFLQGGLTQIPFRCV-----------
A0A2K5PDB1_BAD-03       PT------SGQ--HSA-------MAASSGG--------------------
A0A2K5PIE7_HRK-01       PA--PSALPTYWPWLCAAAQVAALAAWLLGRRNL----------------
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNA
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNA
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMVREIEEVVV-----------------------
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMGIFE----------------------------
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMADWA----------------------------
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNA
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNA
A0A2K5Q1U2_BCL2L11      EI--WIA-QELRRIGDEFNAYYPRRLA-----------KLLASST-----
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMDEATGSSLGIALRREVQWPVEWLAKSS-----
A0A2K5Q1U2_BCL2L11      PS--PTC-QAFNHYLSAMGDIS----------------LWFSQGTEQLHH
                                                                          

A0A2K5QQC6_PMAIP1-      -------------------------------------
A0A2K5QNS7_BBC3-01      -------------------------------------
A0A2K5RN49_BMF-02       -------------------------------------
A0A2K5RN49_BMF-01       GAGLR--------------------------------
A0A2K5QXZ1_BIK-01       -------------------------------------
A0A2K5QNS7_BBC3-02      -------------------------------------
A0A2K5QNS7_BBC3-03      -------------------------------------
A0A2K5PDB1_BAD-01       -------------------------------------
A0A2K5PDB1_BAD-02       -------------------------------------
A0A2K5PDB1_BAD-03       -------------------------------------
A0A2K5PIE7_HRK-01       -------------------------------------
A0A2K5Q1U2_BCL2L11      YYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5Q1U2_BCL2L11      YYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5Q1U2_BCL2L11      -------------------------------------
A0A2K5Q1U2_BCL2L11      -------------------------------------
A0A2K5Q1U2_BCL2L11      -------------------------------------
A0A2K5Q1U2_BCL2L11      YYPRRISLPSD--------------------------
A0A2K5Q1U2_BCL2L11      YYPRRLEK-----------------------------
A0A2K5Q1U2_BCL2L11      -------------------------------------
A0A2K5Q1U2_BCL2L11      -------------------------------------
A0A2K5Q1U2_BCL2L11      KYFS---------------------------------
                                                             

© 1998-2021Legal notice