Dataset for protein Bad of organism Cebus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************               :..
MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHG--------s----gtssp
                                                              gnpsvrtr-rtssypagt
                                                              eagaaeml khra m   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :.      ..         * :          *                . . :                        
--dermqstpsvkrrrlrswrPvlwtsrtyqgrrRtmswtfvpsp-g--r-ktppt----sgs--ytr-------rnlss
etesgghhnentflgqsglsp nvvgdqrpgrel slpvrrsdhfk-lv-prsagaltqmrqqlswsaviqswwdmcflr
ae  eaeeeadaakea daah g aaaelg   i rkgde a a f ap a h   aial  haghg        kaagq

       170 
....:....|.
**         
GG---------
  stqsqfrcv
  lapip    
© 1998-2021Legal notice