Dataset for protein Bad of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5PDB1_BAD-01      MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K5PDB1_BAD-02      MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K5PDB1_BAD-03      MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASH
                       **************************************************

A0A2K5PDB1_BAD-01      QQGQPTSSSHHGGAGAVETRSRHRSYPAGTEEDEGMEEEPSTFRGRSRSA
A0A2K5PDB1_BAD-02      QQGQPTSSSHHG-------------GTSSP--EERGHSNADAAKRQLDAS
A0A2K5PDB1_BAD-03      QQGQPTSSSHHGENPSARMLSKTSAGMSSPATDSEAQHTENVKLEALGLW
                       ************               :..  :.      ..        

A0A2K5PDB1_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSASWTRVI
A0A2K5PDB1_BAD-02      HPVLVGSELGQGRIRSLPVTFAPHP------KTPPALIALSGHLGYGR--
A0A2K5PDB1_BAD-03      RPGVATDRTPQGRRRTKGWRRSPAPFGAVRARHPPT----SGQ--HSA--
                        * :          *                . . :              

A0A2K5PDB1_BAD-01      QSWWDRNLGRGGSAPSQ----
A0A2K5PDB1_BAD-02      -----KCFLQGGLTQIPFRCV
A0A2K5PDB1_BAD-03      -----MAASSGG---------
                                 **         

© 1998-2021Legal notice