Dataset for protein Bim of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgasagervafrvptpaglhwgrrpglesgagsagsvlspgdrlsgaagaaeagaapgltegrgrfgwaapvpeapetsa
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aapaavraraafggefvnnrlafggllagaapaaatdwlrlrxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      **********
----------------------------------------------------------------------MAKQPSDVSS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgsseresralfpappscglsggsrkkdq          
                                           m dpn  tekrkarce fmeqr               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************                                                 
ECDREGGQLQPAERPPQLRPGAPTSLQTERQ-------------------------------------------------
                               gnpegegdrcpqgspqgplappaspgpfatrsplfifvrrssllsrsss
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     *************************************:     
-------drspapmscdkstqtpsppcqafnhylsamASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRvfvrhq
gyfsfdt------------------------------                                     l--ndv
                                                                           er---
                                                                                

       410       420     
....:....|....:....|....:
                         
aieghpqmvlxxvlrylvrlvwrmq
fftsffds--lremssit-------
--------  il------       
          --             
© 1998-2022Legal notice