Dataset for protein Bim of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      MGASAGERVAFRVPTPAGLHWGRRPGLESGAGSAGSVLSPGDRLSGAAGA
A0A8C2P0X3_BCL2L11      MGASAGERVAFRVPTPAGLHWGRRPGLESGAGSAGSVLSPGDRLSGAAGA
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      AEAGAAPGLTEGRGRFGWAAPVPEAPETSAAAPAAVRARAAFGGEFVNNR
A0A8C2P0X3_BCL2L11      AEAGAAPGLTEGRGRFGWAAPVPEAPETSAAAPAAVRARAAFGGEFVNNR
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      LAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      LAFGGLLAGAAPAAATDWLRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2P0X3_BCL2L11      ---MSDPNSRTEKRKARCEGFMEQRRKKDQMAKQPSDVSSECDREGGQLQ
A0A8C2P0X3_BCL2L11      XXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSSECDREGGQLQ
A0A8C2P0X3_BCL2L11      XXGSSERESRALFPAPPSCGLSGGSRKKDQMAKQPSDVSSECDREGGQLQ
A0A8C2P0X3_BCL2L11      ------------------------------MAKQPSDVSSECDREGGQLQ
A0A452FCR6_BCL2L11      ------------------------------MAKQPSDVSSECDREGGQLQ
A0A452FCR6_BCL2L11      ------------------------------MAKQPSDVSSECDREGGQLQ
A0A8C2P0X3_BCL2L11      ------------------------------MAKQPSDVSSECDREGGQLQ
                                                      ********************

A0A8C2P0X3_BCL2L11      PAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFA
A0A8C2P0X3_BCL2L11      PAERPPQLRPGAPTSLQTERQ-----------------------------
A0A8C2P0X3_BCL2L11      PAERPPQLRPGAPTSLQTERQ-----------------------------
A0A8C2P0X3_BCL2L11      PAERPPQLRPGAPTSLQTERQ-----------------------------
A0A452FCR6_BCL2L11      PAERPPQLRPGAPTSLQTERQ-----------------------------
A0A452FCR6_BCL2L11      PAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFA
A0A8C2P0X3_BCL2L11      PAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFA
                        *********************                             

A0A8C2P0X3_BCL2L11      TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A8C2P0X3_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A8C2P0X3_BCL2L11      --------------------------------------------------
A0A8C2P0X3_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A452FCR6_BCL2L11      ---------------------------DRSPAPMSCDKSTQTPSPPCQAF
A0A452FCR6_BCL2L11      TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
A0A8C2P0X3_BCL2L11      TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
                                                                          

A0A8C2P0X3_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQ
A0A8C2P0X3_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRV--NDV
A0A8C2P0X3_BCL2L11      -------ASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRV--NDV
A0A8C2P0X3_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRLER---
A0A452FCR6_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQ
A0A452FCR6_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQ
A0A8C2P0X3_BCL2L11      NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQ
                               *************************************:     

A0A8C2P0X3_BCL2L11      AIEGHPQMVLXXVLRYLVRLVWRMQ
A0A8C2P0X3_BCL2L11      FFTSFFDSVLILEMSSIT-------
A0A8C2P0X3_BCL2L11      FFTSFFDSVLILEMSSIT-------
A0A8C2P0X3_BCL2L11      -------------------------
A0A452FCR6_BCL2L11      AIEGHPQMVLLRVLRYLVRLVWRMQ
A0A452FCR6_BCL2L11      AIEGHPQMVLLRVLRYLVRLVWRMQ
A0A8C2P0X3_BCL2L11      AIEGHPQMVLXXVLRYLVRLVWRMQ
                                                 

© 1998-2022Legal notice