Dataset for protein Puma of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .   .* *.*. ** *::..                   
mararqegsspepveglardgprpfplsrlvpsavscglcepglpaApAaPalLPaAylcaptappa-------------
---------------------------------------vrataev r c cq  r ffsp------xxxxxxxxxxxxx
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           *    
-----------------------------------------------------------------------g---W---p
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgw-epr evp-
                                                                  vtaal aad     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************************
g-g--s----prp-----------p---rGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
-i-pr-rsrs---fpgpgqqlfsv-pqsp                                                   
   lq apcg             s hpid                                                   

       250       260       270       280       290 
....:....|....:....|....:....|....:....|....:....|.
***************************************************
RMADDLNALYERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
                                                   
                                                   
© 1998-2022Legal notice