Dataset for protein Puma of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2RGP9_BBC3-01      ---------------------------------------VRATAEVARAC
A0A452E3G1_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A8C2RGP9_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                                                                 .   .* *.

A0A8C2RGP9_BBC3-01      PCQLPRAFFSP---------------------------------------
A0A452E3G1_BBC3-01      PALLPAAYLCAPTAPPA---------------------------------
A0A8C2RGP9_BBC3-02      PALLPAAYLCAPTAPPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                        *. ** *::..                                       

A0A8C2RGP9_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      ----------------------------------------------VTAA
A0A8C2RGP9_BBC3-02      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
                                                                          

A0A8C2RGP9_BBC3-01      -----W---------------------------VPHQIRGPQPSLSPAEQ
A0A452E3G1_BBC3-01      LGAPRW---PG-GPRSRPRGPRP---------------DGPQPSLSPAEQ
A0A8C2RGP9_BBC3-02      WGEADWEVPPGIGLQSASCSPRPFPGPGQQLFSSPPPSPGPQPSLSPAEQ
                             *                                 ***********

A0A8C2RGP9_BBC3-01      HLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
A0A452E3G1_BBC3-01      HLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
A0A8C2RGP9_BBC3-02      HLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
                        **************************************************

A0A8C2RGP9_BBC3-01      ERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
A0A452E3G1_BBC3-01      ERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
A0A8C2RGP9_BBC3-02      ERRRQEERQRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
                        *****************************************

© 1998-2022Legal notice