Dataset for protein Bad of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************************                     * *:* * ...: 
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKvs-------------------PrPkSqGtpvsv-
                                              glagpqsmsgtvvpgpllsvg d e a latqmv

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                *... *                   : .:.**     .**  : *.                  
----------------RrspsW-------------------trvlsSWwdvplsRGwvspSs------------------
htvrqnvkgpefprss qgar hlcsravpfrypgslasttsefiq  tarnag  gsag qgvlafsprapgtvclgpn

    
....
    
----
qsrs
© 1998-2022Legal notice