Dataset for protein Bad of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0SI24_BAD-02      MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGH
A0A8C0SI24_BAD-01      MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGH
                       **************************************************

A0A8C0SI24_BAD-02      QQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSA
A0A8C0SI24_BAD-01      QQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSA
                       **************************************************

A0A8C0SI24_BAD-02      PPNLCAARRYGRELRRMSDEFQGSFKGL-------------------PRP
A0A8C0SI24_BAD-01      PPNLCAARRYGRELRRMSDEFQGSFKVSAGPQSMSGTVVPGPLLSVGPDP
                       **************************                     * *

A0A8C0SI24_BAD-02      KSAGTATQM-----------------RQSPSW------------------
A0A8C0SI24_BAD-01      ESQGLPVSVVHTVRQNVKGPEFPRSSRRGARWHLCSRAVPFRYPGSLAST
                       :* * ...:                 *... *                  

A0A8C0SI24_BAD-02      -TRVIQSWWDRNLGRGGSAPSQ----------------------
A0A8C0SI24_BAD-01      TSEFLSSWTAVPASRGWVSGSSGVLAFSPRAPGTVCLGPNQSRS
                        : .:.**     .**  : *.                      

© 1998-2022Legal notice