Dataset for protein Bad of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0N2N7_BAD-01      MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGH
Q45KI9_BAD-01          MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGH
                       **************************************************

A0A8C0N2N7_BAD-01      QQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSA
Q45KI9_BAD-01          QQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSA
                       **************************************************

A0A8C0N2N7_BAD-01      PPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVI
Q45KI9_BAD-01          PPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVI
                       **************************************************

A0A8C0N2N7_BAD-01      QSWWDRNLGRGGSAPSQ
Q45KI9_BAD-01          QSWWDRNLGRGGSAPSQ
                       *****************

© 1998-2023Legal notice