Dataset for protein classical BH3-containing proteins of organism Callorhinchus milii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       :  . : :  . . .*    .  ::.:  .   .:..::  :  *** *   :. . 
-----------------------mpisttceniqlspaFittcplfntnffrt---pyspvspssrtSRLsSgyftfdvd
rcsqvqvktytgmsrgrqsvqsdfqsnrstqldsddev aqdltapdsgysdntsgthesltwratr   r pinsvhfc
m  gf fhelpdkre elggp   dl d e                                                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .* ..***:****                                  **    :  :                   
iglmaRptsCDKsTQTP----------------------------------SPtcqaiylarqa---------sl-ltsv
gpgcg qvq   a    tsipgsdlaepslpggvgahprrlfygnagyrlg  evfevprsshtphqgrldst--ssqqk
                                                             hglla apg hmpmi mpe
                                                                       gl  e ana

       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
       ..:*  :     .             .  .                         
qflg-nhnreLemmvmryssqcvkgvhlkstpfnfpvllksl--------------------
prvqvtigkn -qlgiqlpkstmfriermprhvgqviw----vllfamifdpeenrampgqr
nhse g   k qlicdffh m aenh  dengkd  fvwrl                     
d                                                             
© 1998-2020Legal notice