Dataset for protein classical BH3-containing proteins of organism Callorhinchus milii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W3JXA1_BMF-01       -----------------------MDLSDTEELDSDDEVFAQDLTAPDSGY
A0A4W3IWD3_BCL2L11      RCSQFQFHTLTDKREGRQGVPSDFPINTTCENIQLSPAFITTCPLFNTNF
A0A4W3IWD3_BCL2L11      -----------------------MQSSRSTQNIQLSPAFITTCPLFNTNF
A0A4W3IWD3_BCL2L11      MCSGV-VKEYPGMSRGELSGQSDFPINTTCENIQLSPAFITTCPLFNTNF
                                               :  . : :  . . .*    .  ::.:

A0A4W3JXA1_BMF-01       SDNTSGTHESLTWRATRSRLRSPINSVHFCGPGCGRQVQCDKATQTPTSI
A0A4W3IWD3_BCL2L11      FRT---PYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTP---
A0A4W3IWD3_BCL2L11      FRT---PYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTP---
A0A4W3IWD3_BCL2L11      FRT---PYSPVSPSSRTSRLSSGYFTFDVDIGLMARPTSCDKSTQTP---
                          .   .:..::  :  *** *   :. .     .* ..***:****   

A0A4W3JXA1_BMF-01       PGSDLAEPSLPGGVGAHPRRLFYGNAGYRLGSPEVFEVPRSSGLPHQGRG
A0A4W3IWD3_BCL2L11      -------------------------------SPTCQAIYLARQALAQAPL
A0A4W3IWD3_BCL2L11      -------------------------------SPTCQAIYLARQA------
A0A4W3IWD3_BCL2L11      -------------------------------SPTCQAIYLAHHT------
                                                       **    :  :         

A0A4W3JXA1_BMF-01       DGMPMELQPEDRVEVGIGRKLQQIGDQFHSSCMERHHRMENHVDQPFWWR
A0A4W3IWD3_BCL2L11      DHTSLSLMSVNFLG-NHNRELEMMVMRYSKQCVKGVHLKSTPFNFPVLLK
A0A4W3IWD3_BCL2L11      ------LAQAPHSQ-THGKNL-LLCIFLPSMTAFNIELDPRGKGFVIV--
A0A4W3IWD3_BCL2L11      -SLSLISTNKQFLG-NHNRELEMMVMRYSKQCVKGVHLKSTPFNFPVLLK
                                         ..:*  :     .             .  .   

A0A4W3JXA1_BMF-01       LLVLLFAMIFDPEENRAMPGQR
A0A4W3IWD3_BCL2L11      SL--------------------
A0A4W3IWD3_BCL2L11      ----------------------
A0A4W3IWD3_BCL2L11      SL--------------------
                                              

© 1998-2020Legal notice