Dataset for protein classical BH3-containing proteins of organism Bubo bubo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             .  .*                              
----------------------------------------i---psslsC------------------------------
mdrpsyleedyssldgldddvfhsddfglagqpgemtath-ltqnqhyc llgrfqlfplthccgpgirhpeqqdkatqt
                                      mg frdk                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :. .  :    :     *   . . .                : .                . * : :   .   
--pssaspsymlsctvtvvstaLvlrragyrw---------------qsr--------e--ia--lqrIldqftrlycpr
lsipesnqevlfprgtsseprr qygniasklhvppvgfaldphlqeephslqrevrp-vw--rk-rk gnllnkshiqe
   kc g dph f ccaeaec  f f   d                 dl egaedaqa iq  qe  c a e ha f   

       170       180       190   
....:....|....:....|....:....|...
                                 
----r------l---lh---l-a-a--------
hqqntvtvwwq-sls--rlp-p-p-srnltqrr
     nqfifl fif  nga n e nhlhlgqp
© 1998-2022Legal notice