Dataset for protein classical BH3-containing proteins of organism Bubo bubo

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C0EIQ9_PMAIP1-01       ---------------------------------------------PSGLS
A0A8C0EML4_BMF-01          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C0FLD7_BCL2L11-01      MH---------------------------------------ILRDKSHLC
                                                                         *  .

A0A8C0EIQ9_PMAIP1-01       CPKEANPSPH----------------------------------------
A0A8C0EML4_BMF-01          LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C0FLD7_BCL2L11-01      CIPCAGPEYLFFCCCSSVSTALVLFRAASRWQSHSLA-------------
                                                                             

A0A8C0EIQ9_PMAIP1-01       ------------------------------LSRTTAVA--ECALQLRRIG
A0A8C0EML4_BMF-01          RRLFYGNAGYRLHVPPVGFALDPHLQEEPREGQREARAEVQIARKLQCIA
A0A8C0FLD7_BCL2L11-01      ---------------------------------EDVQPEIWIAQELRRIG
                                                              . .    * :*: *.

A0A8C0EIQ9_PMAIP1-01       DKWDLR-----------------Q-----KILNLLTKLFCPET
A0A8C0EML4_BMF-01          DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
A0A8C0FLD7_BCL2L11-01      DEFNASYCPR----RVTFIFLLSISLHRGPLPAPASHLLLQRP
                           *::.                          :    .:    . 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice