Dataset for protein classical BH3-containing proteins of organism Bubo bubo

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0EML4_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C0EIQ9_PMAIP1-      --------------------------------------------PSGLSC
A0A8C0FLD7_BCL2L11      --------------------------------------MHILRDKSHLCC
                                                                     .  .*

A0A8C0EML4_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C0EIQ9_PMAIP1-      --------------------------------PKEANPSPHLSRTTAVAE
A0A8C0FLD7_BCL2L11      --------------------------------IPCAGPEYLFFCCCSSVS
                                                           :. .  :    :   

A0A8C0EML4_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPREGQREARAEVQIARKLQCIA
A0A8C0EIQ9_PMAIP1-      CALQLRRIGDKW---------------DLR----------------QKIL
A0A8C0FLD7_BCL2L11      TALVLFRAASRW---------------QSHSLAEDVQPEIWIAQELRRIG
                          *   . . .                : .                . * 

A0A8C0EML4_BMF-01       DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
A0A8C0EIQ9_PMAIP1-      NLLTKLFCPE----T----------------------------
A0A8C0FLD7_BCL2L11      DEFNASYCPR----RVTFIFLLSISLHRGPLPAPASHLLLQRP
                        : :   .                                    

© 1998-2022Legal notice