Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------r---g-----------------------------------------rs-lfr-
msnqyllklrrarfncdeegysqalns-tst-ggggtlsraeqceqpetgdstpvsqpsklhftmnsmltyst--t---t
        ms psnratrppflmstga gaae                pc gda rg pa d   dhlfgiqdedpasep
                      keqal aqs                                            d   e
                          e  cd                                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ...       :                                      .                           
l-msdsgddvfttepspp-s-------------------ikqeerptqtpgpp--r--------------rl---saqln
-swdseeyvskvsdkeswr-pisvispiddhdesrwseavqsvtvgqtlsvrspa-tngmlpcgiseepr--fyg-rgyl
 grn qpst  dm  trsh kedd               llmisssekdrse my dtssdellevggrv  ysevqvri
 cd    ef   a                          g hhda                             q siva
                                                                            i h 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   .                          .           ..:*. :.*:*  :                   .   
llapserservgdamfreghrdgepfrrrshsaparlw-a---gqqLrrigDeF--dhmldrgn-r-r--gagrqrqnsp
isrweanlqqsqasrhegevgavdsrpgpargvepai-a-kkyark qmms q yqetwyqqrml-v-tt----ptnrqw
fnmnqdaened sgaeddlaphpahh phrqadmqsmqkiwyi  e  k       nkl fksdkvhnsgepqlhmsqga
 q l rirgdr  fqsfp pngcp c aa a  agdh yh                 dg eh ag  cga laiea ce 
 h i  d  aa   elc  c   n                                     g  v   ck          

       250       260        
....:....|....:....|....:...
  :                         
swf-----lw-glfeeepre---rr---
lslrlasaaytwtlkrslsqhss--rrr
ffiprpafvfmlskiqrgaaflrsepae
ah       llrhhl qdlmagh  d  
        a      s          
© 1998-2022Legal notice