Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9LSW6_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A8B9LSW6_BMF-02       --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPG
A0A3B1JLM2_BAD-01       MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGG---------------
A0A8B9KQD8_BAD-01       MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGG---------------
A0A8B9HBP0_BCL2L11      -----------------------ALGLRGCDGGGGGTLSRAEQCEQPEPG
A0A3B1IH05_BAD-01       ----------------------MSTAARAAAG----------------TC
A0A8B9JSR5_BAD-01       ----------------------MSTAARAAAG----------------TC
                                                                          

A0A8B9LSW6_BMF-01       --------------------------------MDDEEDDVFVTDPEPWRS
A0A3B1K1X5_BMF-01       --------------------------------MDDEEDDVFVTDPEPWRS
A0A8B9LSW6_BMF-02       --------------------------------MDDEEDDVFVTDPEPWRS
A0A3B1JXK6_BCL2L11      DGDPVRGPPALH---NSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSP--
A0A3B1JLM2_BAD-01       -----------------------RDTLFRPLCWNSSGSTVFTMEKTPPHS
A0A8B9KQD8_BAD-01       -----------------------RDTLFRPLCWNSSGSTVFTMEKTPPHS
A0A8B9HBP0_BCL2L11      DGDPVRGPPALH---NSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSP--
A0A3B1IH05_BAD-01       DSTAVSQPSKLDFTMDHMFTISDESDASEELGDSDQPEVSKTAEPSRS--
A0A8B9JSR5_BAD-01       DSTAVSQPSKLDFTMDHMFTISDESDASEELGDSDQPEVSKTAEPSRS--
                                                         ...       :      

A0A8B9LSW6_BMF-01       PISV---------------IKQEERGTQTPGRPPARTNGMLPCGISEEPR
A0A3B1K1X5_BMF-01       PISV---------------IKQEERGTQTPGRPPARTNGMLPCGISEEPR
A0A8B9LSW6_BMF-02       PISV---------------IKQEERGTQTPGRPPARTNGMLPCGISEEPR
A0A3B1JXK6_BCL2L11      -------------------LLMHSASTQTPSPS-----------------
A0A3B1JLM2_BAD-01       KEDDISPIDDHDESRWSEAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRV
A0A8B9KQD8_BAD-01       KEDDISPIDDHDESRWSEAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRV
A0A8B9HBP0_BCL2L11      -------------------LLMHSASTQTPSPS-----------------
A0A3B1IH05_BAD-01       -------------------GQHITVPEKLRVEP-----------------
A0A8B9JSR5_BAD-01       -------------------GQHITVPEKLRVEP-----------------
                                                        .                 

A0A8B9LSW6_BMF-01       RLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI---
A0A3B1K1X5_BMF-01       RLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI---
A0A8B9LSW6_BMF-02       RLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI---
A0A3B1JXK6_BCL2L11      ---SQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYI
A0A3B1JLM2_BAD-01       RLYSESQVYNINRWEDNENQDGASAEDGGVGDGAPFRGRSQSAPAALWKA
A0A8B9KQD8_BAD-01       RLYSESQVYNINRWEDNENQDGASAEDGGVGDGAPFRGRSQSAPAALWKA
A0A8B9HBP0_BCL2L11      ------SQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAH
A0A3B1IH05_BAD-01       ------RQRNFSMNEEALQESGAGRHEDGARDGDSFRRRSRSAPPSLWAA
A0A8B9JSR5_BAD-01       ------RQRNFSMNEEDLQESGAGRHEDGARDGDSFRRRSRSAPPSLWAA
                                  :   .                          .        

A0A8B9LSW6_BMF-01       ---GQKLQMIGDQFYQEHMLDGSNVVHCCKELGIERSCSARHFPRPAFVL
A0A3B1K1X5_BMF-01       ---GQKLQMIGDQFYQEHMLQHRN----------QRNQQPLWLRLASALY
A0A8B9LSW6_BMF-02       ---GQKLQMIGDQFYQEHMLQHRN----------QRNQQPLWLRLASALY
A0A3B1JXK6_BCL2L11      ---AQELRRIGDEF--NDLYFRGAGR-NGGGAQLPAQNEPAFI-----LW
A0A3B1JLM2_BAD-01       KKYGRQLRRMSDEF--DTWLDKGDLR-RTTGPGRHTNRGWFSF-----LW
A0A8B9KQD8_BAD-01       KKYGRQLRRMSDEF--DTWLDKGDLR-RTTGPGRHTNRGWFSF-----LW
A0A8B9HBP0_BCL2L11      WYIAQELRRIGDEF--NDLYFRGAGR-NGGGAQLPAQNEPAFI-----LW
A0A3B1IH05_BAD-01       KKYGRQLRKMSDEF--DKGLEQGMKRVRSAGAARQMQNSPSWF-----AF
A0A8B9JSR5_BAD-01       KKYGRQLRKMSDEF--DKGLEQGMKRVRSAGAARQMQNSPSWF-----AF
                           ..:*. :.*:*  :                   .     :       

A0A8B9LSW6_BMF-01       ARHFLQQSLM--------
A0A3B1K1X5_BMF-01       TLLFEREPAAHGRREDRR
A0A8B9LSW6_BMF-02       TLLFEREPAAHGRREDRR
A0A3B1JXK6_BCL2L11      MGLLIERLRQFLHRRR--
A0A3B1JLM2_BAD-01       -GTKEEEGRE--------
A0A8B9KQD8_BAD-01       -GTKEEEGRE--------
A0A8B9HBP0_BCL2L11      MGLLIERLRQFLHRRR--
A0A3B1IH05_BAD-01       LWSHKESDSEASSSRPAE
A0A8B9JSR5_BAD-01       LWSHKESDSEASSSRPAE
                                          

© 1998-2022Legal notice