Dataset for protein Bmf of organism Astyanax mexicanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************:  *          :*. .. .:  .: : :  * .:.     
EEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHMLqhrN----------qRnqqplwlrlasalytllFerepaahgr
                                     dgs vvhcckelgie scsarhfprpafvlarh lqqslm---

     
....:
     
redrr
-----
© 1998-2022Legal notice