Dataset for protein Bmf of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9LSW6_BMF-01      MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISE
A0A3B1K1X5_BMF-01      MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISE
A0A8B9LSW6_BMF-02      MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISE
                       **************************************************

A0A8B9LSW6_BMF-01      EPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI
A0A3B1K1X5_BMF-01      EPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI
A0A8B9LSW6_BMF-02      EPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI
                       **************************************************

A0A8B9LSW6_BMF-01      GQKLQMIGDQFYQEHMLDGSNVVHCCKELGIERSCSARHFPRPAFVLARH
A0A3B1K1X5_BMF-01      GQKLQMIGDQFYQEHMLQHRN----------QRNQQPLWLRLASALYTLL
A0A8B9LSW6_BMF-02      GQKLQMIGDQFYQEHMLQHRN----------QRNQQPLWLRLASALYTLL
                       *****************:  *          :*. .. .:  .: : :  

A0A8B9LSW6_BMF-01      FLQQSLM--------
A0A3B1K1X5_BMF-01      FEREPAAHGRREDRR
A0A8B9LSW6_BMF-02      FEREPAAHGRREDRR
                       * .:.          

© 1998-2022Legal notice