Dataset for protein classical BH3-containing proteins of organism Anser brachyrhynchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqt
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   *                                     .    * :*. *.*:        
-----------l-crvtrsPwr----------------------------------raevwiAreLrrIgDqfnrs----
lspssssqtvp-pqneeep ralfygnagyrlhvppvgfaldphlqeepqegqqeadpviqc qk qc a kahlrqril
      ffdlm l gaa e a                                      ae  l       e dal    

       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
      .  .                                               
------ycprt--------------------------l-l----l------------
nliaklhiqkrviflfllsislhlvqqsrstvwwqly-m-pqlq-nvhhnrsltpqr
      f   h              gfninqsltckf f hnia hleaannhfgad
© 1998-2022Legal notice