Dataset for protein classical BH3-containing proteins of organism Anser brachyrhynchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9BPF5_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8B9CHC1_PMAIP1-      --------------------------------------------------
A0A8B9I6Q1_BCL2L11      --------------------------------------------------
                                                                          

A0A8B9BPF5_BMF-01       LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8B9CHC1_PMAIP1-      ------------------------------------FFTLPLLCNAERSP
A0A8B9I6Q1_BCL2L11      -------------------------------------------QREARPP
                                                                         *

A0A8B9BPF5_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
A0A8B9CHC1_PMAIP1-      AR----------------------------------DAVAECALELRRIG
A0A8B9I6Q1_BCL2L11      WA----------------------------------RPEIWIAQELRRIG
                                                             .    * :*. *.

A0A8B9BPF5_BMF-01       DQFHRL----------HIQRH--------------QQNRNQVWWQLFLFL
A0A8B9CHC1_PMAIP1-      DKADLRQRILNLIAKLFCPKT-----------------------------
A0A8B9I6Q1_BCL2L11      DEFNAS----------YCPRRVIFLFLLSISLHLVGFSISTSLTCKYLML
                        *:              .  .                              

A0A8B9BPF5_BMF-01       HNLALNVEANRNHTGQR
A0A8B9CHC1_PMAIP1-      -----------------
A0A8B9I6Q1_BCL2L11      PQIQLHLHHANSLFPAD
                                         

© 1998-2022Legal notice