Dataset for protein Bim of organism Anas platyrhynchos

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************           **:* **   :.*: . :                       
EEIQPEIWIAQELRRIGDEFNASYCPRR-----------VIiLrLLsyslrLvwrrq-----------------------
                            gfldnhvgnpq  f f  hiiih iskmenpstlpfprlweeesevealvtt

 
.
 
-
c
© 1998-2023Legal notice