Dataset for protein Bim of organism Anas platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9T738_BCL2L11      GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCD
A0A8B9T738_BCL2L11      GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCD
                        **************************************************

A0A8B9T738_BCL2L11      KATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEF
A0A8B9T738_BCL2L11      KATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEF
                        **************************************************

A0A8B9T738_BCL2L11      NASYCPRRGFLDNHVGNPQVIILRLLHYIIRLIWRMQ-------------
A0A8B9T738_BCL2L11      NASYCPRR-----------VIFLFLLSISLHLVSKRENPSTLPFPRLWEE
                        ********           **:* **   :.*: . :             

A0A8B9T738_BCL2L11      -----------
A0A8B9T738_BCL2L11      ESEVEALVTTC
                                   

© 1998-2023Legal notice