Dataset for protein vNR13 of organism all

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A663ECE3_vNR13-01 vNR13 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=vNR13 (length=177 residues).
MPSSLKEETALLLEDYFQHRGGGAALPPSPTAATLRRAAAELERRERPFFRSCAPLARAEPREAAALLERVAAQLEAEGG
LNWGRLLALVVFAGTLAAALTERGCGDGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFGRHGSQPADQSSTISNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|A0A3L8SM77_vNR13-01 vNR13 protein OS=[Eukaryota] Chloebia gouldiae GN=vNR13 (length=177 residues).
MPRSLKEETALLLEDYFQHRSGSAALPPSPTAAALRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCSDGPRCLAAHLAAYLAEERGEWLEAHGGWDGFCRFFGRHGSEAAEQSSTIGNAIM
AAAAGIGMAGLAFLLVR
>gnl|bcl2dbpro|Q90343_vNR13-01 vNR13 protein OS=[Eukaryota] Coturnix japonica GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLETDGG
LNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|H3ALX7_vNR13-01 vNR13 protein OS=[Eukaryota] Latimeria chalumnae GN=vNR13 (length=178 residues).
MCDSLKEETRLLANDFIQFCLGSGRTAPNPAARVLRRVTAELERQNQALFDSFQGNCGPEAELGSVLKRVAEQLEAEGGL
NWGRVVSLFAFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGWDGFYKFFERSDHYQESTVRNAL
MAAAGFGIAGLAFLLAVR
>gnl|bcl2dbpro|Q9DH00_vNR13-01 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=179 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCRFFARFGPGLGEASQTFPLGLI
VAAAGIGITVLIVVWQFQS
>gnl|bcl2dbpro|Q9DH00_vNR13-02 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=162 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
RW
>gnl|bcl2dbpro|A0A670KGT8_vNR13-01 vNR13 protein OS=[Eukaryota] Podarcis muralis GN=vNR13 (length=183 residues).
MPGALREETVQLMADYLQHRLGGGGGAAALPPSRTAETLRRVADELESRERPFFRSACTAAALPQEPGEAAALLGRVAAQ
MEAEGGLNWGRVVALVVFAGNLAAALAERGARDQTAALAEALAAYLAGEKREWLEAHGGWDGFYHFFNKHGSDAADQNST
ISNAIMAAAGFGLAGLAFLLAVR
>gnl|bcl2dbpro|A0A672TYX3_vNR13-01 vNR13 protein OS=[Eukaryota] Strigops habroptila GN=vNR13 (length=177 residues).
MPSSLKEETALLLEDYFQHRRGGSALPPSPTAATLRRAAAELERQERVFFRSCAPLARAEPQEATALLGRVAVQLEADGG
LNWGRLLALVVFAGTLAAALDERGCADGPRCLAAALAAYLAEERGEWLEAHGGWDGFCRFFSRQGSETAEQSSTISNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|A0A674GY73_vNR13-01 vNR13 protein OS=[Eukaryota] Taeniopygia guttata GN=vNR13 (length=177 residues).
MPRSLKEETALLLEDYFQHRSGSAALPPSPTAAVLRRAAAELERQERPFFRSCAPLARAEPREAAALLGRVAAQLEADGG
LNWGRLLALVVFAGTLAAALAERGCSDGPRCLAAHLAAYLAEERGEWLEAHGGWDGFCRFFGRHGSEAAEQSSTIGNAIM
AAAAGIGMAGLAFLLVR
>gnl|bcl2dbpro|A0A674KEW6_vNR13-01 vNR13 protein OS=[Eukaryota] Terrapene carolina triunguis GN=vNR13 (length=178 residues).
MPGSLKEQTALLLGDYFQHRLGGPALPPPSPAAETLRRAASELESRERPFFRACRPLALDERREPAALLSRVAEQLEAEG
GLNWGRVLALVVFAGSLAAALAEQGSREEAGRLAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQNSTISSAI
MAAAGFGLAGLAVLLAVR
© 1998-2022Legal notice