Dataset for protein vNR13 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9DH00_vNR13-01         MADSLKEETALLLEDYFQHC----CGKEGPPPSPTAAELRRAAAELERRE
Q9DH00_vNR13-02         MADSLKEETALLLEDYFQHC----CGKEGPPPSPTAAELRRAAAELERRE
A0A670KGT8_vNR13-0      MPGALREETVQLMADYLQHRLGGGGGAAALPPSRTAETLRRVADELESRE
Q90343_vNR13-01         MPGSLKEETALLLEDYFQHR----AGGAALPPSATAAELRRAAAELERRE
A0A3L8SM77_vNR13-0      MPRSLKEETALLLEDYFQHR----SGSAALPPSPTAAALRRAAAELERQE
A0A674GY73_vNR13-0      MPRSLKEETALLLEDYFQHR----SGSAALPPSPTAAVLRRAAAELERQE
A0A663ECE3_vNR13-0      MPSSLKEETALLLEDYFQHR----GGGAALPPSPTAATLRRAAAELERRE
A0A672TYX3_vNR13-0      MPSSLKEETALLLEDYFQHR----RGGSALPPSPTAATLRRAAAELERQE
H3ALX7_vNR13-01         MCDSLKEETRLLANDFIQFCL----GSGRTAPNPAARVLRRVTAELERQN
A0A674KEW6_vNR13-0      MPGSLKEQTALLLGDYFQHRL---GGPALPPPSPAAETLRRAASELESRE
                        *  :*.*:*  *  *::*.      *    .*. :*  ***.: *** .:

Q9DH00_vNR13-01         RPFFRS----CAPLA--SGGTQAALSALQSVVSELNSGSGFNWGRCLATI
Q9DH00_vNR13-02         RPFFRS----CAPLA--SGGTQAALSALQSVVSELNSGSGFNWGRCLATI
A0A670KGT8_vNR13-0      RPFFRS----ACTAAALPQEPGEAAALLGRVAAQMEAEGGLNWGRVVALV
Q90343_vNR13-01         RPFFRS----CAPLA--RAEPREAAALLRKVAAQLETDGGLNWGRLLALV
A0A3L8SM77_vNR13-0      RPFFRS----CAPLA--RAEPREAAALLGRVAAQLEADGGLNWGRLLALV
A0A674GY73_vNR13-0      RPFFRS----CAPLA--RAEPREAAALLGRVAAQLEADGGLNWGRLLALV
A0A663ECE3_vNR13-0      RPFFRS----CAPLA--RAEPREAAALLERVAAQLEAEGGLNWGRLLALV
A0A672TYX3_vNR13-0      RVFFRS----CAPLA--RAEPQEATALLGRVAVQLEADGGLNWGRLLALV
H3ALX7_vNR13-01         QALFDSFQGNCGPEA-------ELGSVLKRVAEQLEAEGGLNWGRVVSLF
A0A674KEW6_vNR13-0      RPFFRA----CRPLA--LDERREPAALLSRVAEQLEAEGGLNWGRVLALV
                        . :* :    . . *          : *  *. :::: .*:**** :: .

Q9DH00_vNR13-01         VLGGSLATALYENGCEEGP-----SRLAAALAAYLAEEQGEWLREHGGWD
Q9DH00_vNR13-02         VLGGSLATALYENGCEEGP-----SRLAAALAAYLAEEQGEWLREHGGWV
A0A670KGT8_vNR13-0      VFAGNLAAALAERGARDQT-----AALAEALAAYLAGEKREWLEAHGGWD
Q90343_vNR13-01         VFAGTLAAALAESACEEGP-----SRLAAALTAYLAEEQGEWMEEHGGWD
A0A3L8SM77_vNR13-0      VFAGTLAAALAERGCSDGP-----RCLAAHLAAYLAEERGEWLEAHGGWD
A0A674GY73_vNR13-0      VFAGTLAAALAERGCSDGP-----RCLAAHLAAYLAEERGEWLEAHGGWD
A0A663ECE3_vNR13-0      VFAGTLAAALTERGCGDGP-----RCLAAALAAYLAEERGEWLEAHGGWD
A0A672TYX3_vNR13-0      VFAGTLAAALDERGCADGP-----RCLAAALAAYLAEERGEWLEAHGGWD
H3ALX7_vNR13-01         AFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGWD
A0A674KEW6_vNR13-0      VFAGSLAAALAEQGSREEA-----GRLAEVLASYLAEEKREWLEAHGGWD
                        .:.* ** .:      : .       **  *. *** *. :*:  :*** 

Q9DH00_vNR13-01         GFCR--FFARFGPGLGEASQTFPLGLIVAAAGIGITVLIVVWQFQS
Q9DH00_vNR13-02         STARAGMSGSFGSPVSARSEEHRARR---------------W----
A0A670KGT8_vNR13-0      GFYH--FFNKHGSDAADQNSTISNAIM-AAAGFGLAGLAFLLAVR-
Q90343_vNR13-01         GFCR--FFGRHGSQPADQNSTLSNAIM-AAAGFGIAGLAFLLVVR-
A0A3L8SM77_vNR13-0      GFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGMAGLAFLL-VR-
A0A674GY73_vNR13-0      GFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGMAGLAFLL-VR-
A0A663ECE3_vNR13-0      GFCR--FFGRHGSQPADQSSTISNAIM-AAAGFGIAGLAFLLVVR-
A0A672TYX3_vNR13-0      GFCR--FFSRQGSETAEQSSTISNAIM-AAAGFGIAGLAFLLVVR-
H3ALX7_vNR13-01         GFYK--FFERSDHY---QESTVRNALM-AAAGFGIAGLAFLLAVR-
A0A674KEW6_vNR13-0      GFCH--FFNGHGSQPTDQNSTISSAIM-AAAGFGLAGLAVLLAVR-
                        .  .  :    .      ..                          

© 1998-2022Legal notice