Dataset for protein vNR13 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3ALX7_vNR13-01         MCDSLKEETRLLANDFIQFCL---GSGRT-APNPAARVLRRVTAELERQN
A0A8D0KNJ6_vNR13-0      MPGALREETVRLLGDYLQHRL---GRGAAPPPSRPAETLRRVADELESRE
Q9DH00_vNR13-01         MADSLKEETALLLEDYFQHCC---GKEGP-PPSPTAAELRRAAAELERRE
Q9DH00_vNR13-02         MADSLKEETALLLEDYFQHCC---GKEGP-PPSPTAAELRRAAAELERRE
A0A670KGT8_vNR13-0      MPGALREETVQLMADYLQHRLGGGGGAAALPPSRTAETLRRVADELESRE
A0A8C5RRS8_vNR13-0      MPGALREETAQLLGDYVQHRL---GGAALPPPSRAAETLRRVADELESRE
A0A8C6YHI4_vNR13-0      MPGALREETAQLLGDYVQHRL---GGAALPPPSRTAETLRRVADELESRE
A0A8C4VQB8_vNR13-0      MPGSLKEQTALLLGDYFQHRL---GDAALPPPSPAAETLRRVASELESRE
A0A8C3IX63_vNR13-0      MPGSLKEQTALLLGDYFQHRL---GGPALPPPSPAAETLRRAASELESRE
A0A674KEW6_vNR13-0      MPGSLKEQTALLLGDYFQHRL---GGPALPPPSPAAETLRRAASELESRE
A0A8C3SNB5_vNR13-0      MPGSLKEQTVLLLGDYFQHRL---GGPALPPPSPAAETLRRAASELESRE
A0A8D0L3Y5_vNR13-0      MPGALEEETALLLADYFQHRL---GGAAL-PPSPTAQTLRRVAGELESRE
A0A8D2LWG1_vNR13-0      MPGALREETAQLLADYFQHRL---GAAAL-PPSRTAETLRRVADELESRE
A0A8C8VNX1_vNR13-0      MPGSLKEQTALLLADYFQHRL---GGAAA-APSPAAETLRRAASELESRE
A0A8C7EHJ2_vNR13-0      MPGSLKEETALLLQDYFEHRR---GGAAL-PPSATAATLRRAAGELERRE
A0A3L8SM77_vNR13-0      MPRSLKEETALLLEDYFQHRS---GSAAL-PPSPTAAALRRAAAELERQE
A0A674GY73_vNR13-0      MPRSLKEETALLLEDYFQHRS---GSAAL-PPSPTAAVLRRAAAELERQE
A0A8B9GHZ4_vNR13-0      MPGSLKEETALLLEDYFQHRS---GGSAL-PPSPTAATLRRAAAELERQE
A0A672TYX3_vNR13-0      MPSSLKEETALLLEDYFQHRR---GGSAL-PPSPTAATLRRAAAELERQE
A0A8C2U8D6_vNR13-0      MPGSLKEETALLLEDYFQHRA---GGAAL-PPSATAAELRRAAAELERRE
Q90343_vNR13-01         MPGSLKEETALLLEDYFQHRA---GGAAL-PPSATAAELRRAAAELERRE
A0A663ECE3_vNR13-0      MPSSLKEETALLLEDYFQHRG---GGAAL-PPSPTAATLRRAAAELERRE
A0A8C3KMB5_vNR13-0      MPGSLKEETALLLEDYFQHRG---GGSAL-PPSPTAAVLRRAAAELERRE
A0A8D0KT43_vNR13-0      MPGSLKEETALLLEDYFQHRG---GGAAL-PPSPTAATLRRAAAELERRE
                        *  :* *:*  *  *:.:.     *     .*. .*  ***.: *** .:

H3ALX7_vNR13-01         QALFDSFQGNCGPE-------AELGSVLKRVAEQLEAEGGLNWGRVVSLF
A0A8D0KNJ6_vNR13-0      RPF---FRSACSSAGALPEEPGEAAALLSRVAAQMEAEGGLNWGRVVALV
Q9DH00_vNR13-01         RPF---FR-SCAPL-ASG-GTQAALSALQSVVSELNSGSGFNWGRCLATI
Q9DH00_vNR13-02         RPF---FR-SCAPL-ASG-GTQAALSALQSVVSELNSGSGFNWGRCLATI
A0A670KGT8_vNR13-0      RPF---FRSACTAA-ALPQEPGEAAALLGRVAAQMEAEGGLNWGRVVALV
A0A8C5RRS8_vNR13-0      RLF---FRNACSAA-ALP-EPGEAAALLGRVATQMEAEGGLNWGRVVALV
A0A8C6YHI4_vNR13-0      RLF---FRNACSAA-ALP-EPGEAAALLGRVATQMEAEGGLNWGRVVALV
A0A8C4VQB8_vNR13-0      RPF---FR-ACRPL-ALD-ERREPAALLSRVAEQLEAEGGLNWGRVLALV
A0A8C3IX63_vNR13-0      RPF---FR-ACRPL-ALD-ERREPAALLSRVAEQLEAEGGLNWGRVLALV
A0A674KEW6_vNR13-0      RPF---FR-ACRPL-ALD-ERREPAALLSRVAEQLEAEGGLNWGRVLALV
A0A8C3SNB5_vNR13-0      RPF---FR-ACRPL-ALD-ERRDPAALLSRVAEQLEAEGGLNWGRVLALV
A0A8D0L3Y5_vNR13-0      RPF---FRSACRPL-ALA-EPGEPAALLARVAAELEAEGGLNWGRVLALV
A0A8D2LWG1_vNR13-0      RPF---FRDACGAA-AAA-EPGEAAALLGRVAAQMEAEGGLNWGRVVALV
A0A8C8VNX1_vNR13-0      RPF---FR-ACRPL-ALD-ERREPAALLARVAEQLEAEGGLNWGRVLALV
A0A8C7EHJ2_vNR13-0      RPF---FR-SCAAL-ARA-EPWEAAALLARVAAQLEAEGGLNWGRLLALV
A0A3L8SM77_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLGRVAAQLEADGGLNWGRLLALV
A0A674GY73_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLGRVAAQLEADGGLNWGRLLALV
A0A8B9GHZ4_vNR13-0      RVF---FR-SCAPL-ARA-EPQEATALLERVAVQLEADGGLNWGRILALV
A0A672TYX3_vNR13-0      RVF---FR-SCAPL-ARA-EPQEATALLGRVAVQLEADGGLNWGRLLALV
A0A8C2U8D6_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLRKVAAQLEADGGLNWGRLLALV
Q90343_vNR13-01         RPF---FR-SCAPL-ARA-EPREAAALLRKVAAQLETDGGLNWGRLLALV
A0A663ECE3_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLERVAAQLEAEGGLNWGRLLALV
A0A8C3KMB5_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLRRVAAQLEADGGLNWGRLLALV
A0A8D0KT43_vNR13-0      RPF---FR-SCAPL-ARA-EPREAAALLERVAAQLEADGGLNWGRLLALV
                        . :   *.  * .            : *  *. :::: .*:**** :: .

H3ALX7_vNR13-01         AFAGCLAKGVQRAQNE---ECAMGACCGKLAEALVNYLAKERGDWLEENG
A0A8D0KNJ6_vNR13-0      VFAGNLAAALAERGARGDEETP-----GALAEALAAYLAGEKREWLEAHG
Q9DH00_vNR13-01         VLGGSLATALYENGCE---EGP-----SRLAAALAAYLAEEQGEWLREHG
Q9DH00_vNR13-02         VLGGSLATALYENGCE---EGP-----SRLAAALAAYLAEEQGEWLREHG
A0A670KGT8_vNR13-0      VFAGNLAAALAERGAR---DQT-----AALAEALAAYLAGEKREWLEAHG
A0A8C5RRS8_vNR13-0      VFAGNLAAALAERGGP---DHS-----GALVEALAAYLAEERRDWLEAHG
A0A8C6YHI4_vNR13-0      VFAGNLAAALAERGAP---DHS-----GALVEALAAYLAEERRDWLEAHG
A0A8C4VQB8_vNR13-0      VFAGSLAAALAEQGSR---EEA-----GRLAEVLASYLAEEKREWLEAHG
A0A8C3IX63_vNR13-0      VFAGSLAAALAEQGSR---EEA-----GRLAEVLASYLAEEKREWLEAHG
A0A674KEW6_vNR13-0      VFAGSLAAALAEQGSR---EEA-----GRLAEVLASYLAEEKREWLEAHG
A0A8C3SNB5_vNR13-0      VFAGSLAAALAEQGSR---EEA-----GRLAEVLAAYLAEEKREWLEAHG
A0A8D0L3Y5_vNR13-0      VFAGSLAEALVERGAR---EET-----GRLAEVLSTYLAGEKREWLEANG
A0A8D2LWG1_vNR13-0      VFAGNLAAALAERGAR---DET-----GALVEALAAYLAGEKREWLEAHG
A0A8C8VNX1_vNR13-0      VFAGSLAAALAEHGSR---EEA-----GRLAEVLAAYLAEEKREWLEAHG
A0A8C7EHJ2_vNR13-0      VFAGALAAAMAERGCA---DGP-----RRLAAALTDYLAEEKGAWLEAHG
A0A3L8SM77_vNR13-0      VFAGTLAAALAERGCS---DGP-----RCLAAHLAAYLAEERGEWLEAHG
A0A674GY73_vNR13-0      VFAGTLAAALAERGCS---DGP-----RCLAAHLAAYLAEERGEWLEAHG
A0A8B9GHZ4_vNR13-0      VFAGTLAAALDERGCT---DGP-----RCLAAALAAYLAEERGEWLEAHG
A0A672TYX3_vNR13-0      VFAGTLAAALDERGCA---DGP-----RCLAAALAAYLAEERGEWLEAHG
A0A8C2U8D6_vNR13-0      VFAGTLAAALTESGCE---EGP-----SRLAAALTAYLAEEQGEWMEEHG
Q90343_vNR13-01         VFAGTLAAALAESACE---EGP-----SRLAAALTAYLAEEQGEWMEEHG
A0A663ECE3_vNR13-0      VFAGTLAAALTERGCG---DGP-----RCLAAALAAYLAEERGEWLEAHG
A0A8C3KMB5_vNR13-0      VFAGTLAAALAERGCG---EGP-----RCLAAALAAYLAEERGEWLEAHG
A0A8D0KT43_vNR13-0      VFAGTLAAALAERGCG---DGP-----RCLAAALAAYLAEERGEWLEAHG
                        .:.* ** .:         : .       *.  *  *** *.  *:  :*

H3ALX7_vNR13-01         GWDGFYK--FFERSDHY---QESTVRNALM-AAAGFGIAGLAFLLAVR-
A0A8D0KNJ6_vNR13-0      GWDGFYH--FFNKHGSDAAEQNSAISNAIM-AAAGFGLAGLAFLLAVR-
Q9DH00_vNR13-01         GWDGFCR--FFARFGPGLGEASQTFPLGLIVAAAGIGITVLIVVWQFQS
Q9DH00_vNR13-02         GWVSTARAGMSGSFGSPVSARSEEHRARR---------------W----
A0A670KGT8_vNR13-0      GWDGFYH--FFNKHGSDAADQNSTISNAIM-AAAGFGLAGLAFLLAVR-
A0A8C5RRS8_vNR13-0      GWDGFYH--FFNKHGSDAADQNSTISNAIM-AAAGFGLAGLAFLLVVR-
A0A8C6YHI4_vNR13-0      GWDGFYH--FFNKHGSDAADQNSTISNAIM-AAAGFGLAGLAFLLVVR-
A0A8C4VQB8_vNR13-0      GWDGFCH--FFNGHGSQPTDQSSTISSAIM-AAAGFGLAGLAVLLAVR-
A0A8C3IX63_vNR13-0      GWDGFCH--FFNGHGSQPTDQNSTISSAIM-AAAGFGLAGLAVLLAVR-
A0A674KEW6_vNR13-0      GWDGFCH--FFNGHGSQPTDQNSTISSAIM-AAAGFGLAGLAVLLAVR-
A0A8C3SNB5_vNR13-0      GWDGFCH--FFKGHGSQPNDQSSTISSAIM-AAAGFGLAGLAVLLAVR-
A0A8D0L3Y5_vNR13-0      GWDGFYH--FFNKHGSQPTDQNSTISNAIM-AAAGFGLAGLAFLLAVR-
A0A8D2LWG1_vNR13-0      GWDGFYH--FFNKHDSDAADQSSTISNAIM-AAAGFGLAGLAFLLAVR-
A0A8C8VNX1_vNR13-0      GWDGFCH--FFNGHGSQPSDQHSTISSAIM-AAAGFGLAGLAFLLAVR-
A0A8C7EHJ2_vNR13-0      GWDGFHH--FF-RQDSQPAEQSNTISNAIM-AAAGFGIAGLAFLLVVR-
A0A3L8SM77_vNR13-0      GWDGFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGMAGLAFLL-VR-
A0A674GY73_vNR13-0      GWDGFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGMAGLAFLL-VR-
A0A8B9GHZ4_vNR13-0      GWDGFCR--FFGRQGSETAEQNSTISNAIM-AAAGFGIAGLAFLLVVR-
A0A672TYX3_vNR13-0      GWDGFCR--FFSRQGSETAEQSSTISNAIM-AAAGFGIAGLAFLLVVR-
A0A8C2U8D6_vNR13-0      GWDGFCR--FFGRHGSQPADQNSTLSNAIM-AAAGFGIAGLAFLLVVR-
Q90343_vNR13-01         GWDGFCR--FFGRHGSQPADQNSTLSNAIM-AAAGFGIAGLAFLLVVR-
A0A663ECE3_vNR13-0      GWDGFCR--FFGRHGSQPADQSSTISNAIM-AAAGFGIAGLAFLLVVR-
A0A8C3KMB5_vNR13-0      GWDGFCR--FFGGHGSQTADQSSTISNAIM-AAAGFGIAGLAFLLVVR-
A0A8D0KT43_vNR13-0      GWDGFCR--FFGGHGSQTADQSSTISNAIM-AAAGFGIAGLAFLLVVR-
                        ** .  .  :    .       .                          

© 1998-2022Legal notice