Dataset for protein vNR13 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H3ALX7_vNR13-01      MCDSLKEETRLLANDFIQFCLGSGRTAPNPAARVLRRVTAELERQNQALF
Q90343_vNR13-01      MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFF
Q9DH00_vNR13-01      MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFF
                     * .****** ** :*::*.  *    .*..:*  ***.:*****.:..:*

H3ALX7_vNR13-01      DSFQGNCGPEAELG-----SVLKRVAEQLEAEGGLNWGRVVSLFAFAGCL
Q90343_vNR13-01      RS----CAPLARAEPREAAALLRKVAAQLETDGGLNWGRLLALVVFAGTL
Q9DH00_vNR13-01      RS----CAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATIVLGGSL
                      *    *.* *        : *. *. :*:: .*:**** :: ..:.* *

H3ALX7_vNR13-01      AKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGW-----DG
Q90343_vNR13-01      AAALAESACEEGP-----SRLAAALTAYLAEEQGEWMEEHGGW-----DG
Q9DH00_vNR13-01      ATALYENGCEEGP-----SRLAAALAAYLAEEQGEWLREHGGWVSTARAG
                     * .:     ** .     ..** **. ***:*.*:*: *:***      *

H3ALX7_vNR13-01      FYKFFERSDHY---QESTVRNALMAAAGFGIAGLAFLLAVR
Q90343_vNR13-01      FCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Q9DH00_vNR13-01      MSGSFGSPVSARSEEHRARRW--------------------
                     :   *         :  :  .                    

© 1998-2020Legal notice