Dataset for protein E1B 19K of organism all

[Download (right click)] [Alignment] [Repertoires]

398 sequence(s)

>gnl|bcl2dbpro|G9G841_E1B19K-01 E1B19K protein OS=[Viruses] Chimpanzee adenovirus Y25 GN=E1B19K (length=187 residues).
MEIWTILEDLHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYSEQFEVILRECPGLFDALNLGHQTHFNQRIVRA
LDFTTPGRSTAAVAFFAFLLDKWSQETHFSRDYQLDFLAVALWRTWKSQRLNAISGYLPVQPLDTLKILNLQESPRARQR
RRQQQRQQEEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|A0A1C8EG46_E1B19K-01 E1B19K protein OS=[Viruses] Cynomolgus adenovirus 1 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQLPEVKPEVAGQGEEQEQKPALRSGLGPPEEN
>gnl|bcl2dbpro|W6EIX6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 11+34 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|W6EIX6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 11+34 GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERACSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFCACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|Q7T8D8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 11 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q7T8D8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 11 GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVMTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|Q7T8D8_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus 11 GN=E1B19K (length=139 residues).
MSGNASFKGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPANSSTLTYATLSSSPLDAAAAAAAASVAANTVLGMGYY
GSIMANSTSSNNPSTLTQDKLLVLLAQLEALTQRLGELSQQVVELRVQTESAVGTAKSK
>gnl|bcl2dbpro|Q8B8U7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 11 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYNQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q32UI6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 14 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q32UI6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 14 GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|B9A5Q1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 19 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A5T7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 19 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|M0QU76_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 20 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEIENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QU76_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 20 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A0B4SJH1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=178 residues).
MEVWAILEDLKQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A0B4SJH1_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|Q2KS85_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2KS85_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 21 GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|A0A075IQ70_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 21a GN=E1B19K (length=178 residues).
MEVWAILEDLKQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A075IQ70_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 21a GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|C5HDR2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 22 GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRI
LNYWLIQPAVPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|C5HDR2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 22 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|D3GBW3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 22 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAVPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUB4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUB4_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|W8CZB0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|W8CZB0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 23 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVASLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMTNSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QUF3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 24 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUF3_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 24 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVMFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QUJ3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 25 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUJ3_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 25 GN=E1B19K (length=495 residues).
MEPGHPTEQGIHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVMFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QUN2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 27 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUN2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 27 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|C4P207_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 28 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|C4P207_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 28 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNETGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|E1CIM6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 29 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|R4HLJ6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 3+7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|R4HLJ6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 3+7 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|M0QTS5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 30 GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QTS5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 30 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QUS9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 32 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFTAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUS9_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 32 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QV08_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 33 GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QV08_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 33 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|Q3ZL02_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 34 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q3ZL02_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 34 GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|D4N3H6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 36 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QV47_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 38 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRETMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QV47_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 38 GN=E1B19K (length=495 residues).
MEPANPPNQGLHPGLHGHASVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGDHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QV87_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 39 GN=E1B19K (length=182 residues).
MDVWTILGDFVKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSTPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QV87_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 39 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LSQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVVDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTVHGCSFFGFNNMCAEIWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QVC7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 42 GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTGAQTFRKFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRI
LNYWLIQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QVC7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 42 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QVG6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 43 GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QVG6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 43 GN=E1B19K (length=495 residues).
MEPANPSDQGLHPGLHGHASVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYKVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QVK6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 44 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QVK6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 44 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|M0QVP5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 45 GN=E1B19K (length=182 residues).
MDVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QVP5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 45 GN=E1B19K (length=495 residues).
MEPANPPNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERSGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|Q4KSL0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 46 GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTGAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUW8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 47 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QUW8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 47 GN=E1B19K (length=495 residues).
MEPANPPNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTINIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A3G9JTX5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 4a GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|A0A3G9K5X3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 4a GN=E1B19K (length=183 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|A0A3G9CMQ4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 4p GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
>gnl|bcl2dbpro|Q3ZKW2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 50 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARSMRTILDYWPVQPLGVAGILRHPPTMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q3ZKW2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 50 GN=E1B19K (length=492 residues).
MDPTNPLQQGIRFGFHSSSFVENMEGSQHEDNLRLLASAASGSSRDTETPTDHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|M0QVT4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 51 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QVT4_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 51 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVASLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0MK43_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 52 GN=E1B19K (length=168 residues).
MDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
GLDPPVED
>gnl|bcl2dbpro|A0MK43_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 52 GN=E1B19K (length=472 residues).
MEQQRQPPVVGVHAGLHGDGSVEGHAAEEGLHLLAGAASAAGPSGGGERAGGDRESESRPGPSSGRLGAEDDPEEGTSGG
ARKKQKTEPEPRNFLNELTVSLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEMALDTFAKVALR
PDKVYTIRRTVNIKKSVYVIGHGALVQVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSVFVTSTQLTLHG
VYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKKCIFERCVIALAVEGYGRIRNNAASENGCFLLLKGTAS
VKHNMICGSGLCPSQLLTCADGNCHTLRTVHIVSHSRRTWPTFEHNMLMRCAVHLGARRGVFMPYQCNFSHTKILLETDS
FPRVCFNGVFDMSMELFKVIRYDETKSRCRSCECGANHLRLYPVTLNVTEELRTDHHMLSCLRTDYESSDEE
>gnl|bcl2dbpro|A0A3Q9FFS0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 53 GN=E1B19K (length=182 residues).
MDVWSILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A3Q9FFS0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 53 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLCSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|E5RWD9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 53 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVACVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|E5RWL1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 53 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A5L5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 54 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A7G5F9T0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHLPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|A0A7G5FB98_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|C7SRS7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASEIARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|J7H4R9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 55 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|A0A1Y1BXT7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 56 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQKILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|E1AI10_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 56 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|E1AI10_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 56 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|E9P585_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 58 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPLEEELD
>gnl|bcl2dbpro|E9P585_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 58 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCYILKNIHVTAHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|G1FC01_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 60a GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|G1FC01_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 60a GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVMFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|G1DE13_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 61 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTFSKVVHRVKEDYREEFENILTDCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLVTVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
>gnl|bcl2dbpro|G1FBW4_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 62 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|G1FBW4_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 62 GN=E1B19K (length=495 residues).
MEPANPPNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|G9JUV5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 63 GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B6C6W8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 64 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|H0PPE7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 65 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|R4HLA0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 66 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|R4HLA0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 66 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATQTGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|H5T740_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 67 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQDEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|K7NG43_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 68 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|K7NG43_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 68 GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNLRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYILGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFRGD
GYNGIVFMANTKLILHGCSFFGVNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSAKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|M0QU41_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 69 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QU41_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 69 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHL7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 71 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHL7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 71 GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|R4HMC6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 7d2 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|R4HMC6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus 7d2 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|W8VNG2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 81 GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDDNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A3G8WIY5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 86 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A3G8WH01_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=163 residues).
MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLASLDLCHHLVFQEKVVRS
LDFSSVGRTVASIAFLATILDKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQEEKEEERNPAV
VEK
>gnl|bcl2dbpro|P04492_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=163 residues).
MELETVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLASLDLCYHLVFQEKVVRS
LDFSSVGRTVASIAFLATILDKWSEKSHLSWDYMLDYMSMQLWRAWLKRRVCIYSLARPLTMPPLPTLQEEKEEERNPAV
VEK
>gnl|bcl2dbpro|P04492_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 12 GN=E1B19K (length=482 residues).
MEREIPPELGLHAGLHVNAAVEGMAEEEGLHLLAGAAFDHAAAADVARGEGGGAEPCGGGEVNMEQQVQEGHVLERGEGP
SCADDRDKQEKKESLKEAAVLSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMECAIKAF
AKLALRPDCSYRITKTVTITSCAYIIGNGAEVEVDTSDRVAFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANT
CLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLAILNEGDAHIRHNAASENACFVL
LKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSN
IMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRHRCRQCECGSSHLELRPIVLNVTEELRSDHLTLSCLRTDYESSDED
DN
>gnl|bcl2dbpro|D3JIR7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 18 GN=E1B19K (length=162 residues).
MELEAVLQSYQGVRQLLQYTSKNTSGFWRYLFGSTLCKVVHRVKEDYRKEFENILAGCPGLLASLDLCHHSIFQEKVVKS
LDFSSAGRTVASIAFLVTVLDKWSQTSQLSWDYMLDYMAMQLWRAWLTRRVCIYSLARPLTMPRLPTLQEEELEQRDPAA
EK
>gnl|bcl2dbpro|D3JIR7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 18 GN=E1B19K (length=474 residues).
MEPDVPAELGLHAGLHGNAAVEGMAHEEGLHLLAGAAFDHAATANVAGGGAGAAGPCGGEVNMEQQVQEGHALDPEEGPS
CAAVNIKRERETVLSRLAVNIMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQLKTHWLEPWEDIESAIKTFAKLALRP
DRSYKISKTITIASYAYIIGNGAIIEVDTSDRVAFRCRMQGMGPGVVGLGGITFINVRFAGDKFKGTLFEANTSLVLHGV
YFLNFSNTCVESWIKVSARGCTFYGCRRGLVGRPKSKMSVKKCLFEKCVLALIVEGDAHIRHNAASENTCFVLVKGMAVL
RHNMVCGVSDQSARRYVTCADGNCHALKTIHVVSHVKHRWPVCDHNMFMRCSMHLGLRRGMFVPFQCNLSHTNVLLEPEV
FSRISLNGVFDLSVELYKVIRYDDTRHRCRQCECGSSHLELRPVLLNVTEELRSDHLTLSCLRTDYESSDEDGN
>gnl|bcl2dbpro|A0A5H2QAX5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMTMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
>gnl|bcl2dbpro|A0A5H2QAX5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=472 residues).
MEREVPPELGLHAGLHDNAFVEGMAEEEGLHLLAGAASNHAAVAGGAAEHYDGGVNMEPQVQEGHEPDPDEGPSCAVVKK
RERKESLKEAVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKAFAKVALRPDC
TYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEANTSVVLHGVYF
LNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKH
NMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHARYCWPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVLLEPEAFS
RVSLNGVFDLSVELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNVTEELRSDHLTLSCLRTDYDSSDEDN
>gnl|bcl2dbpro|D0Z5R9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
>gnl|bcl2dbpro|D2DM83_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 11 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q2KRU2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 16 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2KRU2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 16 GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|R4HLE1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 16 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDNSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|R4HLE1_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 16 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDIETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKSRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|Q7T951_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 35 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|Q2KSL3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2KSL3_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|Q2Y0J3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTKLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q2Y0J3_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 3 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|A0A220VZ73_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFCFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A5J6CTQ0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I1V161_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I1V161_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|P03248_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=270 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDTETPTYHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCRFFGFNNTCEEA
>gnl|bcl2dbpro|P03248_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q5EY83_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAITLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETACFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSVTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|Q5EY83_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDIPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q5EY83_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=80 residues).
MLEPDAFSRVSVTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
>gnl|bcl2dbpro|Q6RK98_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q6RK98_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|Q6RK98_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 GN=E1B19K (length=138 residues).
MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPANSSTLTYATLSSSPLDAAAAAAATAAANTILGMGYYG
SIVANSSSSNNPSTLAEDKLLVLLAQLEALTQRLGELSKQVAQLREQTESAVATAKSK
>gnl|bcl2dbpro|A0A5K6WAR5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=177 residues).
MEAWECLEDFFAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
RQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7D6TSN5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|Q71BY5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=289 residues).
MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDL
LTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEQPGHGCRSCHYH
RRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPARRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNTP
PEIHPVVPLCPIKPVAVRVGGRRRAVECIEDLLNEPGQPLDLSCKRPRP
>gnl|bcl2dbpro|Q71BY5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=243 residues).
MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDL
LTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGPVSEPEPEPEPEPEPARPARR
PKMVPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRRAVECIEDLLNEPGQPLDLSCKR
PRP
>gnl|bcl2dbpro|Q71BY5_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=55 residues).
MRHIICHGGVITEEMAASLLDQLIEEVLCLNLSLSPSQNRNLQDLPGVLKWCLLS
>gnl|bcl2dbpro|Q71BY5_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus C serotype 1 GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A1U9ALK7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 2 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A4P2SGW2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 2 GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A4P2SGW2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus C serotype 2 GN=E1B19K (length=500 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQVAELYPELRRILTITEDGQGLKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQ
LTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVI
MNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILS
EGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLH
LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRP
DHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A6M5E4Y6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 2 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|P03247_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 2 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3G8W3H5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|Q6VGV8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|Q6VGV8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=496 residues).
MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNVVQV
AELYPELRRILTITEDGQGLKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTY
WLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVR
FTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLV
LACTRAEFGSSDEDTD
>gnl|bcl2dbpro|Q6WQ37_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 5 GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALLQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1U5L6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 6 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1U5L6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus C serotype 6 GN=E1B19K (length=495 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPESRPGPSGMNVVQVA
ELFPELRRILTINEDGQGLKGVKRERGASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYW
LQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRF
TGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSR
VRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRR
GVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVL
ACTRAEFGSSDEDTD
>gnl|bcl2dbpro|E1U5L6_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus C serotype 6 GN=E1B19K (length=155 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPESRPGPSGMNVVQPE
SMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|E1U5L6_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus C serotype 6 GN=E1B19K (length=92 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPESRPGPSGMNVVQEG
GVPTLPMQFESH
>gnl|bcl2dbpro|E1CIJ0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 15 GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|F1DT57_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 17 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|F1DT57_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 17 GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERSGPSVGRGVG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P7YWR9_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGGHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P7YWR9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YWY2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MRESMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YWY2_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGVHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P7YXN8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1P7YXN8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGGHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P7YYY5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
IREAMDKNPRSGLDPPLEEELD
>gnl|bcl2dbpro|A0A1P7YYY5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNKGGHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNMHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P8C849_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGGHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A1P8C849_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAALGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A5A7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 8 GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|Q9YL99_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D serotype 9 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|K7ZLN6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D10 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QU02_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D13 GN=E1B19K (length=182 residues).
MDVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|M0QU02_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus D13 GN=E1B19K (length=498 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTNGSIGARGVKRERSDGGNTGMMTELTASLMNRKRPECITWHELQMECRDEVGLMQDKYGLEQIK
THWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMN
MKFNGEKFNGVLFMANSHMTLHGCKFFGFNNMCAEVWGSAKIRGCVYYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEG
NARVRHCSSIETGCFCLVKGTASLKHNVIKGCTDERMYNMLTCDSGVCHILKNIHITSHARKKWPVFENNMLIKCHVHLG
VRRGTFQPYQCNFSQTKLLLESDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDH
LVMACTGTEFSSSGEDTD
>gnl|bcl2dbpro|B2VQE3_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D37 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|B9A681_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus D37 GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|A0A3G8W6L2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQRQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|P10406_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPSLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q2KSG6_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=494 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLFPELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQMTGTDEVSVMHEKFSLEQVKTCW
LEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRF
RGDGYNGTVMANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHNVMTRCNMHLGARRG
MLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVNVTEDLRPDHLVLS
CTGTEFGSSGEESD
>gnl|bcl2dbpro|Q2KSG6_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=166 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLFPELRRVLTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVNVTEDLRPDHLVLSCTGTEFGS
SGEESD
>gnl|bcl2dbpro|Q2KSG6_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=88 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLPCV
>gnl|bcl2dbpro|Q2KSG6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=183 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|Q2KSG6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=139 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAICRYSR
>gnl|bcl2dbpro|Q2KSM8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|Q2KSM8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q2KSM8_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=91 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLPCVWM
>gnl|bcl2dbpro|Q2KSM8_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=496 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLFPELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQLTGTDEVSVMHEKFSLEQVKTC
WLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIR
FRGDGYNGTVFMANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEA
RIRHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHNVMTRCNMHLGAR
RGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLV
LSCTGTEFGSSGEESD
>gnl|bcl2dbpro|Q2KSM8_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=167 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLFPELRRVLTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFG
SSGEESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=483 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLFPELHRV
LTRSSSGRERGIKRERHDETNHRIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIR
NYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMA
NTKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCF
VLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEHNVMTRCNMHLGARRGMFMPYQCNLNY
VKVLLEPDVMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGE
ESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
>gnl|bcl2dbpro|Q5GFC7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q5GFC7_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=154 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLFPELHRV
LTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGEESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=78 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLPCVWM
>gnl|bcl2dbpro|Q5GFC8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
>gnl|bcl2dbpro|A0A142G3J2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 40 GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLANVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
>gnl|bcl2dbpro|P10543_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 40 GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
>gnl|bcl2dbpro|A0A1S6ELT2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEERENL
RAGLDPQTEL
>gnl|bcl2dbpro|A0A3G4W995_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=166 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEENLRAGL
DPQTEL
>gnl|bcl2dbpro|A0A3G8W407_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=165 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEENLRAGLD
PQTEL
>gnl|bcl2dbpro|A0A482EVC6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=472 residues).
MERPNPSVGGVYSGLHDNGPVENPAAEEEGLRLLAGAASARSGSSAGGGGGGGGGGEPEGRSGSSNGIVTEPDPEEGTSS
GQRGEKRKLENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWELALNMFAKVA
LRPDTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFASTTQLTL
HGVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERCILAMVVEGQARIRHNAGSENVCFLLLKGT
ASVKHNMICGTGHSQLLTCADGNCQTLKVIHVVSHQRRPWPVFEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETDA
FSRVWWSGVFDLTIELYKVVRYDELKARCRPCECGANHIRLYPATLNVTEQLRTDHQMLSCLRTDYESSDED
>gnl|bcl2dbpro|A0A482EVC6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSQFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEENL
RAGLDPQTEL
>gnl|bcl2dbpro|B5SNR1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEENL
RAGLDPQTEL
>gnl|bcl2dbpro|F4ZCJ8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=171 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEEEN
LRAGLDPQTEL
>gnl|bcl2dbpro|P10544_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=168 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEENLRA
GLDPQTEL
>gnl|bcl2dbpro|W0S1G8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=168 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEENLRA
GLDPQTEL
>gnl|bcl2dbpro|A0A1Y1BYF1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|A0A513TZR1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYI9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYM9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A5P8KYF0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|A0A5P8KYF0_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|T1UEX7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus A GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
>gnl|bcl2dbpro|T1UEX7_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus A GN=E1B19K (length=472 residues).
MEREVPPELGLHAGLHGNAFVEGMAEEEGLHLLAGAASNHAAVAGGAAEHYDGGVNMEPQVQEGHEPDPDEGPSCAVVKK
RERKESLKETVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKAFAKVALRPDC
TYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEANTSVVLHGVYF
LNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKH
NMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHARYCWPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVMLEPEAFS
RVSLNGVFDLSVELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNVTEELRSDHLTLSCLRTDYESSDEDN
>gnl|bcl2dbpro|A0A0K0PX35_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPSVLE
EEQQEDNPRAGLDPPVEEAEE
>gnl|bcl2dbpro|A0A0K0PX99_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSRGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEEAEE
>gnl|bcl2dbpro|A0A1L7NRH1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|A0A6M6AA96_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLIENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I6LEP5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHRAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|I6LEP5_E1B19K-03 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=373 residues).
MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGN
GAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGC
SFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAG
GHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILR
YDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
>gnl|bcl2dbpro|I6LEP5_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|I6LES1_E1B19K-03 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=373 residues).
MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGN
GAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGC
SFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAG
GHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILR
YDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
>gnl|bcl2dbpro|I6LES1_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|I6LES1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6Q4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6Q4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|J7I6S4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|J7I6S4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLKLLASAASRSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARIRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|J7I6W7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|J7I6W7_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|J7ID56_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATQTGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|J7ID56_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLKQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|Q5UW22_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UE63_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKISRRINIRNACYISGNGAEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|T1UE63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UF50_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MKVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQ
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|T1UF50_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTTSGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|T1UFS4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UFS4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFRSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTGHASGSGGGTARGQPESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVRACECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|T1UIP3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=178 residues).
MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPAMPAVLE
EEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|T1UIP3_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=492 residues).
MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETPTGHASGSGGGAAGGQSESRPGPSGGGVADL
FPELRRVLTRSTSSGQDRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEP
EDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGD
GYNGIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARVRH
CAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVTEDLRPDHLVLACT
GAEFGSSGEETD
>gnl|bcl2dbpro|T1UJX4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
>gnl|bcl2dbpro|T1UJX4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=494 residues).
MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEASTCHASGSGGGTARGQSESRPGPSSGGGGVA
DLSPELQRVLTGSTSTGRDRGVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWL
EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFR
GDGYNGIVFMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRYDDTRSRVRTCECGGKHARFQPVCVDVTEDLRPDHLVIA
RTGAEFGSSGEETD
>gnl|bcl2dbpro|T2CI10_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=495 residues).
MDPTDPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASTASGRSRDPETPTDHASGFGGGAPRGQSESRPGPSGGGGGGV
ADLFPELRRVLTRSTTSGRDRGIKRERNPSGTNPRSELALSLMSRRRPETIWWHEVQNEGRDEVSILQEKYSLEQVKTCW
LEPEDDWEVAIRNYAKIALRPDKLYRITKRINIRNACYISGNGAEVVIDTQDRTVFRCCMMGMWPGVVGMEAVTLMNVKF
RGDGYNGVVFMANTKLILHGCSFFGFNNICVEAWGQVSVRGCSFYACWIATSGRTKSQLSVKKCMFERCNLGILNEGEAR
VSHCASSETGCFILIKGNANVKHNMICGPSDERPYQMLTCAGGHCNMLATVHIVSHPRKKWPVLEHNVMTKCTMHVGGRR
GMLMPYQCNMNNVKVMLEPDAFSRMSLTGIFDMNLQIWKILRYDDTKSRVRACECGGKHARFQPVCVDVTEELRPDHLVI
ACTGAEFGSSGEETD
>gnl|bcl2dbpro|T2CI10_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus B GN=E1B19K (length=181 residues).
MEVWAILEDLRQTRQLLENASDGVSGLWRFWFGGDLARLVFRIKQDYRQEFEKLLDDCPGLFEALNLGHQAHFKEKVLSV
LDFSTPGRTAAAVAFLTFIFDKWIPQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILRHPPTMPAVLE
EEHQEDNPRVGLDPPVEEAEE
>gnl|bcl2dbpro|A0A0G2R248_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A0G2R248_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=496 residues).
MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNVVQV
AELYPELRRILTITEDGQGLKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTY
WLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVR
FTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNS
RVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLV
LACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A291P1B2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
METWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A2H4PJ75_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=178 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQEEARRR
RRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ54_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=176 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRR
QEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJ63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQEE
ARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HJZ5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRVAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNGLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK00_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=210 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HK78_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=209 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3Q9HLF7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SND6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNH4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SNY0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVSPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SP19_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SPV1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=215 residues).
MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSSVRPAIIPTEEQQQQQQQQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A3S9SSS2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIPTEEQQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A6M4W5T4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQEETRR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7D0TLU2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=626 residues).
MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSSNSTSKTKRLLLSSFQPKLVCRIKEDYKWEF
EELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKN
RLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYLQSGLDPRKCHLVHIPQWPPELRRILTINEDGQGLKGVKRERGAS
EATEEVRNLTFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISK
LVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGPGFHRFVNT
CIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
CEALSSQLPTTMLCINHSLKIIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPMVMSKVNLNG
VFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A7D0TN91_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=192 residues).
MRRGLILVTSDLMEAWECLEDFSAVRNLLEQSSNSTSWFWRVLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLG
HQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE
QQQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WG90_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=183 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQQE
EARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WGT1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=171 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEEARRRRRQEQSP
WNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WIC2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=182 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLILLSSVRPAIIPTEQQQQQQQQQQQEE
ARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WIG2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQLQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WJT1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=184 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQQQQ
EEARRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A7L4WK62_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=178 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIRTEEQQQQQQEEARRR
RRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1ARN8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=180 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|E1ARN8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=500 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQ
LTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVI
MNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILS
EGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLH
LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRP
DHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|E1ARN8_E1B19K-04 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=97 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQEGGVPTLPMQFESH
>gnl|bcl2dbpro|E1ARN8_E1B19K-03 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=160 residues).
MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMN
VVQPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J7I6T8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=499 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAAAAAGGSQAAAAAGAEPMEPESRPGPSGMNV
VQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIM
NVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSE
GNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHL
GNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPD
HLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J7I6T8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=179 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQEEARR
RRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4H6_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=501 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGRAAAAAAAAAGGSQAAAAAGAEPMEPESRPGPSGM
NVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIE
QLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVV
IMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGIL
SEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSL
HLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELR
PDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J9Z4H6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4N4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=177 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQEEARRRR
RQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z4N4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=497 residues).
MERRNPSERGVPAGFSGHAFVESSGETQESPATVVFRPPGNNTDGGAAAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQ
VAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTT
YWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNV
RFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGN
SRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGN
RRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHL
VLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|J9Z5H0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|J9Z5H0_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=495 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPESRPGPSGMNVVQVA
ELFPELRRILTINEDGQGLKGVKRERGASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYW
LQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRF
TGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSR
VRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRR
GVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVL
ACTRAEFGSSDEDTD
>gnl|bcl2dbpro|T1UG63_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRTAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|T1UG63_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus C GN=E1B19K (length=501 residues).
MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAAAAAAAAGGSQAAAAAAGAEPMEPESRPGPSGM
NVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIE
QLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVV
IMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGIL
SEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSL
HLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELR
PDHLVLACTRAEFGSSDEDTD
>gnl|bcl2dbpro|A0A075TSZ1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A075TSZ1_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A097I4T0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPPEEELD
>gnl|bcl2dbpro|A0A097I4T0_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSAGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A0G2UY10_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRGHAPVEVLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVMFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A0G2UY10_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRSWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A1J0MS84_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRSWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A291B0H2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILGDFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A384ZUF2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPVLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A384ZUF2_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A384ZUM9_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILSYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A384ZUM9_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVASLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|A0A3S6PYX7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRI
LNYWLIQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A3S6PYX7_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|B6DU90_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|E1CIR1_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|F8UFP5_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHPGLRGHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGRQPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGVRR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEDLRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|F8UFP5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDDNPRSGLDPPSEEELD
>gnl|bcl2dbpro|G3CK71_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHVREPEERPGPSVGRGAG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVMFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|G3CK71_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMYENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UG22_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDKNPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UG22_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGGHGQEPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHSRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UGT5_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHPGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPLFENNLLIKCHVHLGARR
GTFQPYQCNLSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UGT5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGU0_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPANPPNQGLHPGLHGHASVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UGU0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFNKTRRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGX3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSQTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGX3_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UGY3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UGY3_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGAG
LNEVSSLYPELSKVLTSMARGVKRERSDGGNTGLMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRADHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHG3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLCLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHG3_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSLSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHH6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHH6_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSMETGCFCLVKGTASLKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHQ8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVASLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHQ8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UHZ2_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAE
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UHZ2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELN
>gnl|bcl2dbpro|T1UK99_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPANPLNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UK99_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKP8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGIHPGLRSHAPVEVLDQAAGTENLELLASTASSSRSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTVHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UKP8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRSWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKQ0_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPANPLNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQTNIHVGGRDEGGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNAR
VRHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1UKQ0_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFNKTRRLVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKV6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILGDFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1UKV6_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHASVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEGGHGREPEERPGPSVGRGVG
LNQVSSLYPELSRVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1ULJ8_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTTMARGVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCYILKNIHVTAHSRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|T1ULJ8_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1ULP4_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|T1ULP4_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=495 residues).
MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQTNIHVGGRNEAGHGREPEERPGPSVGRGAG
LNQVSSLYPELSKVLTSMARGVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHW
LNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKF
NGEKFNGVLFMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNAR
VRHCSSMETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGARR
GTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVM
ACTGTEFSSSGEDTD
>gnl|bcl2dbpro|X4Y9D2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=208 residues).
MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENL
FADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWRQDTQLSRGYILDFAAMHLWRSWIRQRGQRI
LNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|X4YVU5_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus D GN=E1B19K (length=182 residues).
MEVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLDSLNLGHQALFQERVLHS
LDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWKAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
MREAMDENPRSGLDPPSEEELD
>gnl|bcl2dbpro|A0A2L1F392_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=139 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAICRYSR
>gnl|bcl2dbpro|A0A2R3WN16_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|A0A2R3WN62_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|A0A2R3WNP3_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q6H1D7_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
>gnl|bcl2dbpro|Q6H1D7_E1B19K-02 E1B19K protein OS=[Viruses] Human mastadenovirus E GN=E1B19K (length=483 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLFPELHRV
LTRSSSGRERGIKRERHDETNHRIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIR
NYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMA
NTKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCF
VLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEHNVMTRCNMHLGARRGMFMPYQCNLNY
VKVLLEPDVMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGE
ESD
>gnl|bcl2dbpro|A0A6B9DS29_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=167 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEENLRAG
LDPQTEL
>gnl|bcl2dbpro|A0A6M6AES6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=165 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEENLRAGLD
PQTEL
>gnl|bcl2dbpro|A0A6M6AEV2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
>gnl|bcl2dbpro|A0A0A1EUB2_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 51 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLGRVEEEDEPGEMENLRA
GLDPPTED
>gnl|bcl2dbpro|A0A0A1EUC8_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 52 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
>gnl|bcl2dbpro|A0A0A1EUE4_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 53 GN=E1B19K (length=177 residues).
MGSESTSALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKKEQEGQFSRLLADIPGVFVALDLGHHS
LFQEKIVKSLTFSSPGRTVVSAAFITYILDQWSSSGSHLSWDYMLDYLAMALWRAMLRRRVCIYSRAQPPRLDRVVEEDE
PDETENLRAGLDPPMED
>gnl|bcl2dbpro|A0A2H5AI04_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 54 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
>gnl|bcl2dbpro|A0A2H5AI21_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 55 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
GLDPPVED
>gnl|bcl2dbpro|A0A2H5AI40_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 56 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AI72_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 57 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
>gnl|bcl2dbpro|A0A2H5AI99_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 58 GN=E1B19K (length=167 residues).
MDLLKELRDFDVVRQLLESASDKTSKFWRFCFGSTLSNVVYRVKKEQAEQFSRLLAEIPGVFVALDLGHHALFQEKVIKS
LTFSSPGRVVTSLAFICHLLDKWSSDSHLSWNYMLDYLSMAVWRAMLRKRVCIYLRAQPPRLDRVEEEDEPVETDNPRAG
LDPPVED
>gnl|bcl2dbpro|A0A2H5AIC5_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 59 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AID8_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 60 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AII9_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 61 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AIL3_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 62 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSGSHLSWEYMLDYMSMALWRAMLRRRVCIYLRAQPPRLDRVEEEDEPGETENLRA
GLDPPTED
>gnl|bcl2dbpro|A0A2H5AIL0_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 63 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AIN5_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 64 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AIS9_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 65 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AIT6_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 66 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A2H5AIU0_E1B19K-01 E1B19K protein OS=[Viruses] Rhesus adenovirus 67 GN=E1B19K (length=177 residues).
MGSESTAALMDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLVALDLGHHS
LFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENE
PEETENLRAGLDPPVED
>gnl|bcl2dbpro|A0A0M5L3Y4_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 11 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
GLDPPVED
>gnl|bcl2dbpro|A0A0M3TH18_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 13 GN=E1B19K (length=187 residues).
MKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRKLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVDSLNFCHH
AFFYEKVICGLDFCTPGRTIAALAFCAFILDKWNKETHLSKGYTLDYISLQLWKAYMRKGKIYTFSQGPRSLPQRVRRRL
GFKTEDQTRLLEAEEEPRAGTDPPSET
>gnl|bcl2dbpro|A0A1W5PVU4_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 13 GN=E1B19K (length=188 residues).
MMKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRRLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVDSLNFCH
HAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWNKETHLSRGYTLDYISLQLWKAYMRKGKIYTFSQGPRSLPQRVRRR
LGFQTEDQTRLLEAEEEPRAGMDPPSET
>gnl|bcl2dbpro|A0A0M4N3Z1_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 16 GN=E1B19K (length=183 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEDKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYISLNLWKFWLRRRVYNYSRGLPQLGPVAPLVRQGSQQEEQQQQ
RQEEQQVQEEGEMRSGLDPPTEN
>gnl|bcl2dbpro|A0A2H4CJZ0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 17 GN=E1B19K (length=168 residues).
MEFWSELQNYQSLRHLLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPAVFASLDLGHHVYFQEAVVRY
LDFSTPGRTVSALAFICFVLDRWSAQTRLSPGYTLDYLTMSLWRAMLRKRRVSGFSPARPPHGLDPVLEEPEPEEEENPR
AGLDPSAE
>gnl|bcl2dbpro|H8PFZ1_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 18 GN=E1B19K (length=168 residues).
MEYWSELQNYQSLRRLLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPAVFVSLDLGHHVYFQEAVVRY
LDFSTPGRAVSAIAFICFVLDRWSAQTRLSPGYTLDYLTMSLWRAMLRKRRVSGFSPARPPHGLDPVLEESELEEEENPR
AGLDPPAE
>gnl|bcl2dbpro|A0A0M3TH31_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 19 GN=E1B19K (length=166 residues).
MDLLRLLSDYEVLRKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQRGLERVEEEEEENENPRAG
VDPPLE
>gnl|bcl2dbpro|Q5C8R2_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 1 GN=E1B19K (length=168 residues).
MDLLGDLREFGVVRRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFVALDLGHHSLFQEKIIKN
LTFTSPGRTVASAAFITYILDQWSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
GLDPPVED
>gnl|bcl2dbpro|F6KST6_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 20 GN=E1B19K (length=186 residues).
MDLYESLENLGSLRRLLEEASDRTSYFWRFLCGSPLSRFLNRVKREHRAEFDELLEHLPGLFDSLNLGHRVLLEERLFPQ
LDFSSPGRLCSALAFVVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRKGRKLYRRLVERHPSLRQHRLQAQALLRQEEL
ETILEEEAMNMEEQNPRAGLDPPVEA
>gnl|bcl2dbpro|Q6QPF3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 23 GN=E1B19K (length=190 residues).
MEIWTVLEDFHQTRQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKEQFEDILRECPGIFDSLNLGHQSHFNQSILRA
LDFSTPGRTTAAVAFFAFILDKWSQETHFSRDYRLDCLAVALWRTWRCQRLNAISGYLPVQPVDTLRILSLQSPQEHQRR
QQPQQEQQQEEDREENPRAGLDPPVAEEEE
>gnl|bcl2dbpro|Q6QPB7_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 24 GN=E1B19K (length=192 residues).
MEIWTVLEDFHQTRQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPGIFDSLNLGHQSHFNQSILRA
LDFSTPGRTTAAVAFFAFILDKWSQETHFSRDYRLDCLAVALWRTWRCQRLNAISGYLPVQPVDTLRILSLQSPQEHQRR
QQPQQEQQQEEEEDREENPRAGLDPPVAEEEE
>gnl|bcl2dbpro|Q8UY91_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 25 GN=E1B19K (length=186 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLARLVYRAKQDYSEQFEVILRECSGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFILDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILNLQESPRARQR
RQQQQQEEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|Q695T5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 3 GN=E1B19K (length=185 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEEKNPRAGLDPPAEE
>gnl|bcl2dbpro|Q695T5_E1B19K-02 E1B19K protein OS=[Viruses] Simian adenovirus 3 GN=E1B19K (length=508 residues).
MERADAAQPGLYSGLPDAMPMEVRNQEGEEAVRALGGEASVSAPAASASSSAAEAGGSGSHFGGGERHGREESESGAGPS
GGGVGGIPDPFPELALGAVGGASVVREDEEGRQRGQKREHFESSTFLADVTVALMAKNRLEVVWYPEVWEDFEKGDLHLL
EKYNFEQVKTYWMNPDEDWEVVLNRYGKVALRPDCRYQVRDKVVLRRNVYLLGNGATVEMVDPRRGGFVANMQEMCPGVV
GLSGVTFHSVRFSGSNFGGVVITANTPVVLHNCYFFGFSNTCVEMRVGGKVRGCSFYACWKGVVSQGKAKVSVHKCMLER
CTLGISSEGFLHAGDNVASDNGCAFLIKGGGRICHNMICGPGDVPPKPYQMVTCTDGKVRMLKPVHIVGHRRHRWPEFEH
NVMTRCSLYLGGRRGVFMPRQCNLAHCNVIMEQSAATQVCFGGIFDISMVVYKILRYDDCRARTRTCDCGASHLCNLTVM
GMVTEEVRLDHCQHSCLREEFSSSDEED
>gnl|bcl2dbpro|F2WTG5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 48 GN=E1B19K (length=184 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEENPRAGLDPPAEE
>gnl|bcl2dbpro|F2WTJ7_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 49 GN=E1B19K (length=213 residues).
MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNSQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASLPEEQSPEVKPKVAGQGEEQEQEPALRSGLDPPEEKED
>gnl|bcl2dbpro|F2WTM9_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 50 GN=E1B19K (length=213 residues).
MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMNLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNSQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASLPEEQSPEVKPKVAGQGEEQEQEPALRSGLDPPEEKED
>gnl|bcl2dbpro|H9TER0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 6 GN=E1B19K (length=185 residues).
MDLYESLENLSSLRRLLEEASDRTSYIWRFLFGSPLSRFLHRVKREHLTEFDGLLEQLPGLFDSLNLGHRTLLEERLFPQ
LDFSSPGRLCSALAFAVHLLDRWNEQTQLSPGYTLDFLTLCLWKFGIRRGRKLYGRLVERHPSLRQQRLQAQVLLRREDL
EAISEEESGMEEKNPRAGLDPPAEE
>gnl|bcl2dbpro|A0A0M4NHE0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus 8 GN=E1B19K (length=217 residues).
MINCCELWLFIQRVLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKE
EYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRF
WLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNPEAQGEAKEEALRSGLDPPVEED
>gnl|bcl2dbpro|H9AA76_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1139 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGVVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQSPEVKPEVAGQGEEQEPEPALRSGLDPPEEN
>gnl|bcl2dbpro|H9AAA8_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1163 GN=E1B19K (length=183 residues).
MDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFESLELGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGRASSPEEQSPEVKPEVAG
QGEEQEQEQKPALRSGLDPPEEN
>gnl|bcl2dbpro|H9AAD9_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1173 GN=E1B19K (length=182 residues).
MDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNP
EAQGEAKEETLRSGLDPPVEEN
>gnl|bcl2dbpro|H9AAH3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1258 GN=E1B19K (length=182 residues).
MDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNP
EAQGEAKEETLRSGLNPPVEEN
>gnl|bcl2dbpro|H9AAK5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1285 GN=E1B19K (length=217 residues).
MINGCELWLFIQRGLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLVELCSNRSSWFGRFLFGSTLCRVVRQVKE
EYQSEFEHILSNCPGLFVSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWNAQTQLSPGYTLDYISLQLWRF
WLRRRVYNYSRGLPPLGLASVAEERSEESKPEVNPEAQGEAKEETLRSGLDPPVEEN
>gnl|bcl2dbpro|H9AAN8_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1296 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQSPEVKPEVAGQGEEQEQEPALRSGLDPPEEN
>gnl|bcl2dbpro|H9AAS0_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1312 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQSPEVKPEVAGQGEEQEQEPALRSGLDPPEEN
>gnl|bcl2dbpro|H9AAV3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1327 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQSPEVKPEVAGQGEEQEQEPALRSGLDPPEEN
>gnl|bcl2dbpro|H9AAY5_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus A1335 GN=E1B19K (length=211 residues).
MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSE
FEHILSTCQGLFESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRR
VYNYSRGLPPLGRASSPEEQSPEVKPEVAGQGEEQEQEPALRSGLDPPEEN
>gnl|bcl2dbpro|M9YVA3_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus B GN=E1B19K (length=181 residues).
MDLRVELQTFESTRCLLELCSNRDPWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFESLELGHHTVFQEKIVKA
LDFSSPGRAVAAIAFAAFILDRWNTQTQLSPGYTLDYISLQLWRFWLRRRVYNYSRGLPPLGRASSPEEQSPEVKPEVAG
QGEEQEQEPALRSGLDPPEEN
>gnl|bcl2dbpro|A0A097IW62_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus DM-2014 GN=E1B19K (length=179 residues).
MDLDRVLENYNSLRKVVEEASEQTSGWWRKLFGCRLSCLVVQAKFEYREEFERLFAEVPGLLESLNFCHHAVFYEKIICS
LDFCTPGRTIAALAFCTYILDRWNKETHLSAGYTLDYITLQLWKAYMRKGKIYTFSREPRSLQRLQTSLRRRLGMPTDDR
VCLLEAENPRAGMDPPSEN
>gnl|bcl2dbpro|Q6QPI9_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus E22 GN=E1B19K (length=190 residues).
MEIWTVLEDFHQTRQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPGIFDSLNLGHQSHFNQSILRA
LDFSTPGRTTAAVAFFAFILDKWSQETHFSRDYRLDCLAVALWRTWRCQRLNAISGYLPVQPVDTLRILSLQSPQEHQRR
QQPQQEQQQEEDREENLRAGLDPPVAEEEE
>gnl|bcl2dbpro|A0A076V686_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus ch1 GN=E1B19K (length=161 residues).
MELEAVLQSYQSIRQLLQHTSRNTSGFWRYLFGSTLSKVVHRVKEDYRNEFENILAGCPGLLASLDLCHHSIFQEKVVRS
LDFSSAGRTVASIAFLVTVLDKWSQASQLSWDYMLDYMTMQLWRAWLTRRVCIYSLARPLTMPRLPTLQEEPEERDPAVE
K
>gnl|bcl2dbpro|P06501_E1B19K-01 E1B19K protein OS=[Viruses] Simian adenovirus serotype 7 GN=E1B19K (length=180 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEEKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYISLNLWKFWLRRRVYNYSRGLPQLGPAAPLARQGSQQEEQQQR
QEEEQVQEEMRSGLDPPTEN
>gnl|bcl2dbpro|M9YVF6_E1B19K-01 E1B19K protein OS=[Viruses] Simian mastadenovirus C GN=E1B19K (length=164 residues).
MDLLRLLSDYEVLRKLLETACEKNRSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQQGLERVEEEEEENPRAGVD
PPLE
>gnl|bcl2dbpro|M9YXY5_E1B19K-01 E1B19K protein OS=[Viruses] Simian mastadenovirus C GN=E1B19K (length=166 residues).
MDLLRLLSDYEVLRKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFVSLDLGHHSYFQEKIVKG
LVFESTGRTVVSVAFICFLLDKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQRGLERVEEEEEENENPRAG
VDPPLE
>gnl|bcl2dbpro|A0A1L3INW0_E1B19K-01 E1B19K protein OS=[Viruses] Simian mastadenovirus WIV19 GN=E1B19K (length=180 residues).
MDLYKSLEDRSTLRQLLEEASNSTSYCWRFLFGSPLGRFLYRVKKDHQEEFDQLIGLFPTIFESLNLGHKTLLEDKLLVQ
LDFSTPGRACSGLAFVVHLLDRWNQETYLSPGYTLDFLTLSLWKTGLKRGRKLYGRMLERHPSLIQKTVRAQVLSRWGAL
ENLAEEDPRAGLDPPEEEVD
>gnl|bcl2dbpro|G0ZAH2_E1B19K-01 E1B19K protein OS=[Viruses] Titi monkey adenovirus ECC-2011 GN=E1B19K (length=218 residues).
MDLLKFLEDFENCRQVLQQASKRTGGWSRWLLGNQLVRTVAQVKTDYSEHFEQLLQEQNRLLLNNLELGHTRALNGVLRE
LDFENTGRVVAGLAFLAYLLDRWDENSVLSPGYRLDCLALAIWKHTLREGILRGVMQGPRARVNREIRREVEERLTQVQR
ELEERERERQQREREQQQQEGEMTTSIWRPSMEAEWPPRAGMDPPLEEQWEADHDPEA
>gnl|bcl2dbpro|Q8B6X5_E1B19K-01 E1B19K protein OS=[Viruses] unclassified Simian adenoviruses GN=E1B19K (length=183 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEDKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYIRLNLWKFWLRRRVYNYSRGLPQLGPVAPLVRQGSQQEEQQQQ
RQEEQQVQEEGEMRSGLDPPTEN
© 1998-2021Legal notice