Dataset for protein E1B 19K of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

304 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q5GFC7_E1B19K-04        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
P03248_E1B19K-03        -------------------------------------------------M
D3JIR7_E1B19K-02        -------------------------------------------------M
A0A5H2QAX5_E1B19K-      -------------------------------------------------M
T1UEX7_E1B19K-02        -------------------------------------------------M
R4HLE1_E1B19K-02        -------------------------------------------------M
R4HLA0_E1B19K-02        -------------------------------------------------M
J7ID56_E1B19K-02        -------------------------------------------------M
Q5EY83_E1B19K-02        -------------------------------------------------M
K7NG43_E1B19K-02        -------------------------------------------------M
T1UIP3_E1B19K-02        -------------------------------------------------M
Q2KRU2_E1B19K-02        -------------------------------------------------M
Q2KS85_E1B19K-02        -------------------------------------------------M
Q3ZKW2_E1B19K-02        -------------------------------------------------M
R4HLJ6_E1B19K-02        -------------------------------------------------M
R4HMC6_E1B19K-02        -------------------------------------------------M
Q2Y0J3_E1B19K-02        -------------------------------------------------M
I6LEP5_E1B19K-02        -------------------------------------------------M
T1UF50_E1B19K-02        -------------------------------------------------M
Q3ZL02_E1B19K-02        -------------------------------------------------M
T1UFS4_E1B19K-02        -------------------------------------------------M
W6EIX6_E1B19K-02        -------------------------------------------------M
T1UE63_E1B19K-02        -------------------------------------------------M
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
A0A4P2SGW2_E1B19K-      -------------------------------------------------M
Q6VGV8_E1B19K-02        -------------------------------------------------M
M0QU02_E1B19K-02        -------------------------------------------------M
J7I6T8_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
A0A1P8C849_E1B19K-      -------------------------------------------------M
T1UGY3_E1B19K-02        -------------------------------------------------M
M0QUW8_E1B19K-02        -------------------------------------------------M
M0QVP5_E1B19K-02        -------------------------------------------------M
M0QUS9_E1B19K-02        -------------------------------------------------M
T1UKQ0_E1B19K-02        -------------------------------------------------M
M0QV47_E1B19K-02        -------------------------------------------------M
G1FBW4_E1B19K-02        -------------------------------------------------M
F1DT57_E1B19K-02        -------------------------------------------------M
E9P585_E1B19K-02        -------------------------------------------------M
T1UKP8_E1B19K-02        -------------------------------------------------M
W8CZB0_E1B19K-02        -------------------------------------------------M
T1ULJ8_E1B19K-02        -------------------------------------------------M
M0QUB4_E1B19K-02        -------------------------------------------------M
M0QVT4_E1B19K-02        -------------------------------------------------M
M0QVG6_E1B19K-02        -------------------------------------------------M
T1UK99_E1B19K-02        -------------------------------------------------M
M0QV87_E1B19K-02        -------------------------------------------------M
T1UKV6_E1B19K-02        -------------------------------------------------M
F8UFP5_E1B19K-02        -------------------------------------------------M
T1UGT5_E1B19K-02        -------------------------------------------------M
C5HDR2_E1B19K-02        -------------------------------------------------M
A0A3S6PYX7_E1B19K-      -------------------------------------------------M
A0A097I4T0_E1B19K-      -------------------------------------------------M
A0A384ZUM9_E1B19K-      -------------------------------------------------M
M0QUJ3_E1B19K-02        -------------------------------------------------M
T1UHQ8_E1B19K-02        -------------------------------------------------M
T1UHH6_E1B19K-02        -------------------------------------------------M
T1UHL7_E1B19K-02        -------------------------------------------------M
A0A075TSZ1_E1B19K-      -------------------------------------------------M
M0QVK6_E1B19K-02        -------------------------------------------------M
M0QUN2_E1B19K-02        -------------------------------------------------M
E1AI10_E1B19K-02        -------------------------------------------------M
A0A384ZUF2_E1B19K-      -------------------------------------------------M
C4P207_E1B19K-02        -------------------------------------------------M
M0QTS5_E1B19K-02        -------------------------------------------------M
M0QV08_E1B19K-02        -------------------------------------------------M
M0QU76_E1B19K-02        -------------------------------------------------M
M0QU41_E1B19K-02        -------------------------------------------------M
M0QVC7_E1B19K-02        -------------------------------------------------M
A0A3Q9FFS0_E1B19K-      -------------------------------------------------M
T1UGX3_E1B19K-02        -------------------------------------------------M
T1UHZ2_E1B19K-02        -------------------------------------------------M
A0A0G2UY10_E1B19K-      -------------------------------------------------M
M0QUF3_E1B19K-02        -------------------------------------------------M
G1FC01_E1B19K-02        -------------------------------------------------M
G3CK71_E1B19K-02        -------------------------------------------------M
Q5GFC7_E1B19K-03        -------------------------------------------------M
I6LEP5_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        -------------------------------------------------M
P04492_E1B19K-02        -------------------------------------------------M
A0MK43_E1B19K-02        ------------------------------------------------ME
A0A482EVC6_E1B19K-      -------------------------------------------------M
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------------------------
A0A0M4NHE0_E1B19K-      ------------------------------------------MINCCELW
H9AAK5_E1B19K-01        ------------------------------------------MINGCELW
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        -------------------------------------------------M
F2WTM9_E1B19K-01        -------------------------------------------------M
H9AA76_E1B19K-01        -------------------------------------------------M
A0A1C8EG46_E1B19K-      -------------------------------------------------M
H9AAN8_E1B19K-01        -------------------------------------------------M
H9AAS0_E1B19K-01        -------------------------------------------------M
H9AAV3_E1B19K-01        -------------------------------------------------M
H9AAY5_E1B19K-01        -------------------------------------------------M
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-01        MRHIICHGGVITEEMAA-------------------------SLLDQLIE
Q71BY5_E1B19K-02        MRHIICHGGVITEEMAA-------------------------SLLDQLIE
P03248_E1B19K-03        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
D3JIR7_E1B19K-02        EPDVPAELGLHAGLHGN-------------------------AAVEGM--
A0A5H2QAX5_E1B19K-      EREVPPELGLHAGLHDN-------------------------AFVEGM--
T1UEX7_E1B19K-02        EREVPPELGLHAGLHGN-------------------------AFVEGM--
R4HLE1_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
R4HLA0_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
J7ID56_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
Q5EY83_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
K7NG43_E1B19K-02        DPPNPLQQGIRFGFHSS-------------------------SFVENMEG
T1UIP3_E1B19K-02        DPPNPLQQGIRFGFHSS-------------------------SFVENMEG
Q2KRU2_E1B19K-02        DPPNPLQQGIRFGFHSS-------------------------SFVENMEG
Q2KS85_E1B19K-02        DPPNPLQQGIRFGFHSS-------------------------SFVENMEG
Q3ZKW2_E1B19K-02        DPTNPLQQGIRFGFHSS-------------------------SFVENMEG
R4HLJ6_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
R4HMC6_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
Q2Y0J3_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
I6LEP5_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
T1UF50_E1B19K-02        DPPNSLQQGIRFGFHSS-------------------------SFVENMEG
Q3ZL02_E1B19K-02        DPADSFQQGIRFGFRSH-------------------------SIVENMEG
T1UFS4_E1B19K-02        DPADSFQQGIRFGFRSH-------------------------SIVENMEG
W6EIX6_E1B19K-02        DPADSFQQGIRFGFHSH-------------------------SIVENMEG
T1UE63_E1B19K-02        DPADSFQQGIRFGFHSH-------------------------SIVENMEG
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
A0A4P2SGW2_E1B19K-      ERRNPSERGVPAGFSGH------------------------ASVESGGET
Q6VGV8_E1B19K-02        ERRNPSERGVPAGFSGH------------------------ASVESGCET
M0QU02_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGH-------------------------ASVESGGE
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGH-------------------------ASVESGGE
A0A1P8C849_E1B19K-      EPGHPTKQGLHSGLCSH-------------------------APVEGLDE
T1UGY3_E1B19K-02        EPGHPTKQGLHSGLCSH-------------------------APVEGLDE
M0QUW8_E1B19K-02        EPANPPNQGLHPGLHGH-------------------------APVEGLGQ
M0QVP5_E1B19K-02        EPANPPNQGLHPGLHGH-------------------------APVEGLGQ
M0QUS9_E1B19K-02        EPGHPTEQGLHPGLHGH-------------------------APVEGLGQ
T1UKQ0_E1B19K-02        EPANPLNQGLHPGLHGH-------------------------APVEGLGQ
M0QV47_E1B19K-02        EPANPPNQGLHPGLHGH-------------------------ASVEGLGQ
G1FBW4_E1B19K-02        EPANPPNQGLHPGLHGH-------------------------APVEGLGQ
F1DT57_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGQ
E9P585_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
T1UKP8_E1B19K-02        EPGHPTEQGIHPGLRSH-------------------------APVEVLDQ
W8CZB0_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGLGQ
T1ULJ8_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QUB4_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QVT4_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QVG6_E1B19K-02        EPANPSDQGLHPGLHGH-------------------------ASVEGLGQ
T1UK99_E1B19K-02        EPANPLNQGLHPGLHGH-------------------------APVEGLGQ
M0QV87_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
T1UKV6_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------ASVEGLDQ
F8UFP5_E1B19K-02        EPEHPTEQGLHPGLRGH-------------------------APVEGLDQ
T1UGT5_E1B19K-02        EPEHPTEQGLHPGLRGH-------------------------APVEGLGQ
C5HDR2_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGQ
A0A3S6PYX7_E1B19K-      EPEHPTEQGLHSGLRSH-------------------------APVEGMGQ
A0A097I4T0_E1B19K-      EPEHPTEQGLHSGLRSH-------------------------APVEGMGQ
A0A384ZUM9_E1B19K-      EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QUJ3_E1B19K-02        EPGHPTEQGIHPGLRSH-------------------------APVEGLDQ
T1UHQ8_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
T1UHH6_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEVLDQ
T1UHL7_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEVLDQ
A0A075TSZ1_E1B19K-      EPGHPTEQGLHPGLRSH-------------------------APVEVLDQ
M0QVK6_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QUN2_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
E1AI10_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
A0A384ZUF2_E1B19K-      EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
C4P207_E1B19K-02        EPGHPTEQGLHPGLRSH-------------------------APVEGLDQ
M0QTS5_E1B19K-02        EPEHPTEQGLHSGLRGH-------------------------APVEGLGQ
M0QV08_E1B19K-02        EPEHPTEQGLHSGLRGH-------------------------APVEGLGQ
M0QU76_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGE
M0QU41_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGE
M0QVC7_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGE
A0A3Q9FFS0_E1B19K-      EPEHPTEQGLHSGLCSH-------------------------APVEGMGE
T1UGX3_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGLGQ
T1UHZ2_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGE
A0A0G2UY10_E1B19K-      EPEHPTEQGLHSGLRGH-------------------------APVEVLDQ
M0QUF3_E1B19K-02        EPEHPTEQGLHSGLRSH-------------------------APVEGMGE
G1FC01_E1B19K-02        EPEHPTEQGLHSGLRGH-------------------------APVEGLGQ
G3CK71_E1B19K-02        EPEHPTEQGLHSGLRGH-------------------------APVEGLGQ
Q5GFC7_E1B19K-03        ESRNPFQQGLPAGFLSS-------------------------SFVENMEV
I6LEP5_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        DPTDPLQQGIRFGFHSS-------------------------SFVENMEG
P04492_E1B19K-02        EREIPPELGLHAGLHVN-------------------------AAVEG--M
A0MK43_E1B19K-02        QQRQPPVVGVHAGLHGD-------------------------GSVEG--H
A0A482EVC6_E1B19K-      ERPNPSVGGVYSGLHDN-------------------------GPVEN--P
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------------------------
A0A0M4NHE0_E1B19K-      LFIQRVLPGR----YKGSGF------------------------------
H9AAK5_E1B19K-01        LFIQRGLPGR----YKGSGF------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK78_E1B19K-      MFNLHGVLNG----AGLKGY------------------------------
A0A3S9SPV1_E1B19K-      MFNLHGVLNG----AGLKGY------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      ---MTHGRGL----VLYKWQ------------------------------
X4Y9D2_E1B19K-01        ---MTHGRGL----VLYKWQ------------------------------
C5HDR2_E1B19K-01        ---MTHGRGL----VLYKWQ------------------------------
M0QVC7_E1B19K-01        ---MTHGRGL----VLYKWQ------------------------------
A0A3S6PYX7_E1B19K-      ---MTHGRGL----VLYKWQ------------------------------
Q4KSL0_E1B19K-01        ---MTHGRGL----VLYKWQ------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
F2WTM9_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
H9AA76_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
A0A1C8EG46_E1B19K-      INDVNFVCLF----KGDYLG------------------------------
H9AAN8_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
H9AAS0_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
H9AAV3_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
H9AAY5_E1B19K-01        INDVNFVCLF----KGDYLG------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-01        EVLADNL------------------------PPPSHFEPPTLHELYDLDV
Q71BY5_E1B19K-02        EVLADNL------------------------PPPSHFEPPTLHELYDLDV
P03248_E1B19K-03        SQDEDNLRLL----ASAASR-----------SSRDTETPTYHASGSAGGA
D3JIR7_E1B19K-02        -AHEEGLHLL----AGAAFDHAATANVAGGGAGAAGPCGGEVNMEQQVQE
A0A5H2QAX5_E1B19K-      -AEEEGLHLL----AGAASNHAAVA------GGAAEHYDGGVNMEPQVQE
T1UEX7_E1B19K-02        -AEEEGLHLL----AGAASNHAAVA------GGAAEHYDGGVNMEPQVQE
R4HLE1_E1B19K-02        SQDEDNLRLL----ASAASR-----------SSRDIETPTDHASGSAGGA
R4HLA0_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
J7ID56_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
Q5EY83_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
K7NG43_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTGHASGSGGGA
T1UIP3_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTGHASGSGGGA
Q2KRU2_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTGHASGSGGGA
Q2KS85_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTGHASGSGGGA
Q3ZKW2_E1B19K-02        SQHEDNLRLL----ASAASG-----------SSRDTETPTDHASGSGGGA
R4HLJ6_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
R4HMC6_E1B19K-02        SQDEDNLKLL----ASAASR-----------SSRDTETPTDHASGSAGGA
Q2Y0J3_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
I6LEP5_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
T1UF50_E1B19K-02        SQDEDNLRLL----ASAASG-----------SSRDTETPTDHASGSAGGA
Q3ZL02_E1B19K-02        SQDEDNLRLL----ASAAFG-----------CSGNPEASTGHASGSGGGT
T1UFS4_E1B19K-02        SQDEDNLRLL----ASAAFG-----------CSGNPEASTGHASGSGGGT
W6EIX6_E1B19K-02        SQDEDNLRLL----ASAAFG-----------CSGNPEASTGHASGSGGGT
T1UE63_E1B19K-02        SQDEDNLRLL----ASAAFG-----------CSGNPEASTGHASGSGGGT
A0A7D0TLU2_E1B19K-      LFQEKVIKTL----DFSTPG-----------RAAAAVAFLSFIKDKWSEE
A0A4P2SGW2_E1B19K-      ---QESPATV----VFRPPG-----------NNTDGGAAAAAAAAGGSQA
Q6VGV8_E1B19K-02        ---QESPATV----VFRPPG-----------DNTDGGAAAAA----GGSQ
M0QU02_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
J7I6T8_E1B19K-02        TQESPATVVFRPPGNNTDGG-----------AAAAAAAGGSQ--AAAAAG
T1UG63_E1B19K-02        TQESPATVVFRPPGNNTDGG-----------AAAAAAAAGGSQAAAAAAG
A0A1P8C849_E1B19K-      AAGTENLELL----ASTASS-----------FGSSSSTQTNIHVGGRNEG
T1UGY3_E1B19K-02        AAGTENLELL----ASTASS-----------FGSSSSTQTNIHVGGRNEG
M0QUW8_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
M0QVP5_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
M0QUS9_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
T1UKQ0_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
M0QV47_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
G1FBW4_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
F1DT57_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
E9P585_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1UKP8_E1B19K-02        AAGTENLELL----ASTASS-----------SRSSSSTQTNIHVGGRNEA
W8CZB0_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1ULJ8_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QUB4_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QVT4_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QVG6_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
T1UK99_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
M0QV87_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRDEG
T1UKV6_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
F8UFP5_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
T1UGT5_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEG
C5HDR2_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
A0A3S6PYX7_E1B19K-      AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
A0A097I4T0_E1B19K-      AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
A0A384ZUM9_E1B19K-      AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QUJ3_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1UHQ8_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1UHH6_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1UHL7_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
A0A075TSZ1_E1B19K-      AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QVK6_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QUN2_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
E1AI10_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
A0A384ZUF2_E1B19K-      AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
C4P207_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNET
M0QTS5_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QV08_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QU76_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
M0QU41_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
M0QVC7_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
A0A3Q9FFS0_E1B19K-      AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
T1UGX3_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
T1UHZ2_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
A0A0G2UY10_E1B19K-      AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
M0QUF3_E1B19K-02        AAGTENLELL----AYTASS-----------SGSSSSTQTNIHVGGRNEA
G1FC01_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
G3CK71_E1B19K-02        AAGTENLELL----ASTASS-----------SGSSSSTQTNIHVGGRNEA
Q5GFC7_E1B19K-03        PAPECNLRLL----AGTAAR-----------HSEDPESPA--------AG
I6LEP5_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        SQDEDNLRLL----ASTASG-----------RSRDPETPTD-HASGFGGG
P04492_E1B19K-02        AE-EEGLHLL------AGAA-----------FDHAAAADVARGEGGGAEP
A0MK43_E1B19K-02        AA-EEGLHLL------AG----------------AASA--AGPSGGGERA
A0A482EVC6_E1B19K-      AAEEEGLRLL------AG----------------AASARSGSSAGGGGGG
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-01        TAPED--------------------------------------PNEEA--
Q71BY5_E1B19K-02        TAPED--------------------------------------PNEEA--
P03248_E1B19K-03        AGGQ---------------------------------------SESRP--
D3JIR7_E1B19K-02        GHALD--------------------------------------PEE----
A0A5H2QAX5_E1B19K-      GHEPD--------------------------------------PDE----
T1UEX7_E1B19K-02        GHEPD--------------------------------------PDE----
R4HLE1_E1B19K-02        AGGQ---------------------------------------SESRP--
R4HLA0_E1B19K-02        AGGQ---------------------------------------SESRP--
J7ID56_E1B19K-02        AGGQ---------------------------------------SESRP--
Q5EY83_E1B19K-02        AGGQ---------------------------------------SESRP--
K7NG43_E1B19K-02        AGGQ---------------------------------------SESRP--
T1UIP3_E1B19K-02        AGGQ---------------------------------------SESRP--
Q2KRU2_E1B19K-02        AGGQ---------------------------------------SESRP--
Q2KS85_E1B19K-02        AGGQ---------------------------------------SESRP--
Q3ZKW2_E1B19K-02        AGGQ---------------------------------------SESRP--
R4HLJ6_E1B19K-02        AGGQ---------------------------------------SESRP--
R4HMC6_E1B19K-02        AGGQ---------------------------------------SESRP--
Q2Y0J3_E1B19K-02        AGGQ---------------------------------------SESRP--
I6LEP5_E1B19K-02        AGGQ---------------------------------------SESRP--
T1UF50_E1B19K-02        AGGQ---------------------------------------SESRP--
Q3ZL02_E1B19K-02        ARGQ---------------------------------------PESRP--
T1UFS4_E1B19K-02        ARGQ---------------------------------------PESRP--
W6EIX6_E1B19K-02        ARGQ---------------------------------------PESRP--
T1UE63_E1B19K-02        ARGQ---------------------------------------PESRP--
A0A7D0TLU2_E1B19K-      THLSGGYLLDFLAMHLWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWL
A0A4P2SGW2_E1B19K-      AAAAGAEPME---------------------------------PESRP--
Q6VGV8_E1B19K-02        AAAAGAEPME---------------------------------PESRP--
M0QU02_E1B19K-02        GHGRE--------------------------------------PEERP--
J7I6T8_E1B19K-02        AEPME--------------------------------------PESRP--
T1UG63_E1B19K-02        AEPME--------------------------------------PESRP--
A0A1P8C849_E1B19K-      GHGQE--------------------------------------PEERP--
T1UGY3_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QUW8_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QVP5_E1B19K-02        GHGRE--------------------------------------PEERS--
M0QUS9_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UKQ0_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QV47_E1B19K-02        DHGRE--------------------------------------PEERP--
G1FBW4_E1B19K-02        GHGRE--------------------------------------PEERP--
F1DT57_E1B19K-02        GHGRE--------------------------------------PEERS--
E9P585_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UKP8_E1B19K-02        GHGRE--------------------------------------PEERP--
W8CZB0_E1B19K-02        GHGRE--------------------------------------PEERP--
T1ULJ8_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QUB4_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QVT4_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QVG6_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UK99_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QV87_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UKV6_E1B19K-02        GHGRE--------------------------------------PEERP--
F8UFP5_E1B19K-02        GHGRQ--------------------------------------PEERP--
T1UGT5_E1B19K-02        GHGRE--------------------------------------PEERP--
C5HDR2_E1B19K-02        GHGRE--------------------------------------PEERP--
A0A3S6PYX7_E1B19K-      GHGRE--------------------------------------PEERP--
A0A097I4T0_E1B19K-      GHGRE--------------------------------------PEERP--
A0A384ZUM9_E1B19K-      GHGRE--------------------------------------PEERP--
M0QUJ3_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UHQ8_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UHH6_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UHL7_E1B19K-02        GHGRE--------------------------------------PEERP--
A0A075TSZ1_E1B19K-      GHGRE--------------------------------------PEERP--
M0QVK6_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QUN2_E1B19K-02        GHGRE--------------------------------------PEERP--
E1AI10_E1B19K-02        GHGRE--------------------------------------PEERP--
A0A384ZUF2_E1B19K-      GHGRE--------------------------------------PEERP--
C4P207_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QTS5_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QV08_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QU76_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QU41_E1B19K-02        GHGRE--------------------------------------PEERP--
M0QVC7_E1B19K-02        GHGRE--------------------------------------PEERP--
A0A3Q9FFS0_E1B19K-      GHGRE--------------------------------------PEERP--
T1UGX3_E1B19K-02        GHGRE--------------------------------------PEERP--
T1UHZ2_E1B19K-02        GHGRE--------------------------------------PEERP--
A0A0G2UY10_E1B19K-      GHGRE--------------------------------------PEERP--
M0QUF3_E1B19K-02        GHGRE--------------------------------------PEERP--
G1FC01_E1B19K-02        GHGRE--------------------------------------PEERP--
G3CK71_E1B19K-02        GHVRE--------------------------------------PEERP--
Q5GFC7_E1B19K-03        GSRRE--------------------------------------SESRP--
I6LEP5_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        APRGQ--------------------------------------SESRP--
P04492_E1B19K-02        CGGGE--------------------------------------VNMEQ--
A0MK43_E1B19K-02        GGDRE--------------------------------------SESRP--
A0A482EVC6_E1B19K-      GGGGE--------------------------------------PEGRS--
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------------MESR--------
A0A0M4NHE0_E1B19K-      ---------------QARGIYPLAAF--MDLRAELQTFESTR--------
H9AAK5_E1B19K-01        ---------------QARGIYPLAAF--MDLRAELQTFESTR--------
G0ZAH2_E1B19K-01        ----------------------------MDLLKFLEDFENCR--------
A0A3Q9HK78_E1B19K-      ---------------IMRRGLILVTFDLMEAWECLEDFSAVR--------
A0A3S9SPV1_E1B19K-      ---------------IMRRGLILVTFDLMEAWECLEDFSAVR--------
A0A1W5PVU4_E1B19K-      -----------------MMKRPVAAEVQMELDRLLENYNSLR--------
A0A0M3TH18_E1B19K-      ------------------MKRPVAAEVQMELDRLLENYNSLR--------
A0A097IW62_E1B19K-      ----------------------------MDLDRVLENYNSLR--------
A0A0A1EUE4_E1B19K-      -------------------MGSESTSALMDLLGNLREFDVVR--------
A0A2H5AI40_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AID8_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AII9_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIL0_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIN5_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIS9_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIT6_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIU0_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A2H5AIC5_E1B19K-      -------------------MGSESTAALMDLLGNLREFDVVR--------
A0A0G2UY10_E1B19K-      ---------------HLGTWAQTFREFLMDVWTILADFSKTR--------
X4Y9D2_E1B19K-01        ---------------HLGTRAQTFREFLMDVWTILADFSKTR--------
C5HDR2_E1B19K-01        ---------------HLGTWAQTFREFLMDVWTILADFSKTR--------
M0QVC7_E1B19K-01        ---------------HLGTGAQTFRKFLMDVWTILADFSKTR--------
A0A3S6PYX7_E1B19K-      ---------------HLGTWAQTFREFLMDVWTILADFSKTR--------
Q4KSL0_E1B19K-01        ---------------HLGTGAQTFREFLMDVWTILADFSKTR--------
A0A1P8C849_E1B19K-      ----------------------------MDVWSILGEFNKTR--------
T1UGY3_E1B19K-01        ----------------------------MDVWSILGEFNKTR--------
H5T740_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
A0A1J0MS84_E1B19K-      ----------------------------MDVWTILADFSKTR--------
A0A097I4T0_E1B19K-      ----------------------------MDVWTILADFSKTR--------
E5RWD9_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QU76_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A7R6T9I9_E1B19K-      ----------------------------MDVWTILADFSKTR--------
D3GBW3_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QUF3_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QU41_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
F1DT57_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
B2VQE3_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
T1UHZ2_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A3Q9FFS0_E1B19K-      ----------------------------MDVWSILADFSKTR--------
T1ULJ8_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
E9P585_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
T1UHL7_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A075TSZ1_E1B19K-      ----------------------------MDVWTILADFSKTR--------
T1UHH6_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
T1UKP8_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A291B0H2_E1B19K-      ----------------------------MDVWTILGDFSKTR--------
B9A5Q1_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QUB4_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QUJ3_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QUN2_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
C4P207_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
E1CIM6_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
D4N3H6_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QVK6_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
M0QVT4_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
E1AI10_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
H0PPE7_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A3G8WIY5_E1B19K-      ----------------------------MDVWTILADFSKTR--------
Q9YL99_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
A0A384ZUF2_E1B19K-      ----------------------------MDVWTILADFSKTR--------
A0A384ZUM9_E1B19K-      ----------------------------MDVWTILADFSKTR--------
T1UHQ8_E1B19K-01        ----------------------------MDVWTILADFSKTR--------
W8VNG2_E1B19K-01        ----------------------------MEVWTILGDFNKTR--------
F8UFP5_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
M0QV87_E1B19K-01        ----------------------------MDVWTILGDFVKTR--------
M0QU02_E1B19K-01        ----------------------------MDVWTILADFNKTR--------
T1UKV6_E1B19K-01        ----------------------------MDVWTILGDFNKTR--------
M0QV47_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
M0QUW8_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
E1CIJ0_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
M0QVG6_E1B19K-01        ----------------------------MEVWTILADFSKTR--------
X4YVU5_E1B19K-01        ----------------------------MEVWTILADFSKTR--------
M0QUS9_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
G1FBW4_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
M0QVP5_E1B19K-01        ----------------------------MDVWTILADFNKTR--------
T1UKQ0_E1B19K-01        ----------------------------MDVWTILADFNKTR--------
W8CZB0_E1B19K-01        ----------------------------MEVWTILGDFNKTR--------
G1FC01_E1B19K-01        ----------------------------MEVWTILGDFNKTR--------
G3CK71_E1B19K-01        ----------------------------MEVWTILGDFNKTR--------
T1UGT5_E1B19K-01        ----------------------------MEVWTILADFNKTR--------
T1UK99_E1B19K-01        ----------------------------MEVWTILGDFNKTR--------
M0QTS5_E1B19K-01        ----------------------------MEVWTILADFSKTR--------
M0QV08_E1B19K-01        ----------------------------MEVWTILADFSKTR--------
G9JUV5_E1B19K-01        ----------------------------MEVWTILADFSKTR--------
T1UGX3_E1B19K-01        ----------------------------MDVWTILADFSQTR--------
Q7T951_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
T1UE63_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
Q8B8U7_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
Q5UW22_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
W6EIX6_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
Q3ZL02_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
T1UFS4_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
A0A7G5F9T0_E1B19K-      ----------------------------MEVWAILEDLRKTR--------
C7SRS7_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
D2DM83_E1B19K-01        ----------------------------MEVWAILEDLRKTR--------
T2CI10_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
A0A0K0PX99_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
A0A0K0PX35_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
A0A8B0L9Y2_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
J7ID56_E1B19K-01        ----------------------------MEVWAILEDLKQTR--------
A0A6M6AA96_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
A0A220VZ73_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
A0A8B0LD36_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
A0A8B0LBX6_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
R4HLE1_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
R4HMC6_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
P03248_E1B19K-02        ----------------------------MEVWAILEDLRQTR--------
Q2KS85_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
Q3ZKW2_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
K7NG43_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
Q2KRU2_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
A0A8B0LCV0_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
T1UIP3_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
R4HLJ6_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
R4HLA0_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
Q2Y0J3_E1B19K-01        ----------------------------MEVWAILEDLRQTK--------
A0A5J6CTQ0_E1B19K-      ----------------------------MEVWAILEDLRQTR--------
Q5EY83_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
I6LEP5_E1B19K-01        ----------------------------MEVWAILEDLRQTR--------
T1UF50_E1B19K-01        ----------------------------MKVWAILEDLRQTR--------
Q6QPF3_E1B19K-01        ----------------------------MEIWTVLEDFHQTR--------
Q6QPB7_E1B19K-01        ----------------------------MEIWTVLEDFHQTR--------
Q6QPI9_E1B19K-01        ----------------------------MEIWTVLEDFHQTR--------
P10406_E1B19K-01        ----------------------------MEIWTVLEDFHKTR--------
Q5GFC7_E1B19K-02        ----------------------------MEIWTVLEDFHKTR--------
A0A2R3WN62_E1B19K-      ----------------------------MEIWTVLEDFHKTR--------
A0A3G8W6L2_E1B19K-      ----------------------------MEIWTVLEDFYKTR--------
Q5GFC7_E1B19K-01        ----------------------------MEIWTVLEDFHKTR--------
G9G841_E1B19K-01        ----------------------------MEIWTILEDLHKTR--------
Q8UY91_E1B19K-01        ----------------------------MEIWTVLEDFHKTR--------
A0A1L3INW0_E1B19K-      ----------------------------MDLYKSLEDRSTLR--------
P06501_E1B19K-01        ----------------------------MDLRTALQTFESTR--------
A0A0M4N3Z1_E1B19K-      ----------------------------MDLRTALQTFESTR--------
Q8B6X5_E1B19K-01        ----------------------------MDLRTALQTFESTR--------
H9AAD9_E1B19K-01        ----------------------------MDLRAELQTFESTR--------
H9AAH3_E1B19K-01        ----------------------------MDLRAELQTFESTR--------
H9AAA8_E1B19K-01        ----------------------------MDLRVELQTFESTR--------
M9YVA3_E1B19K-01        ----------------------------MDLRVELQTFESTR--------
F2WTJ7_E1B19K-01        ---------------GIKGAAVGLGHFTMDLRVELQTFESTR--------
F2WTM9_E1B19K-01        ---------------GIKGAAVGLGHFTMNLRVELQTFESTR--------
H9AA76_E1B19K-01        ---------------GIKGVVVRLGHFTMDLRVELQTFESTR--------
A0A1C8EG46_E1B19K-      ---------------GIKGAVVRLGHFTMDLRVELQTFESTR--------
H9AAN8_E1B19K-01        ---------------GIKGAVVRLGHFTMDLRVELQTFESTR--------
H9AAS0_E1B19K-01        ---------------GIKGAVVRLGHFTMDLRVELQTFESTR--------
H9AAV3_E1B19K-01        ---------------GIKGAVVRLGHFTMDLRVELQTFESTR--------
H9AAY5_E1B19K-01        ---------------GIKGAVVRLGHFTMDLRVELQTFESTR--------
F6KST6_E1B19K-01        ----------------------------MDLYESLENLGSLR--------
A0A7L4WGT1_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A3S9SP19_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A291P1B2_E1B19K-      ----------------------------METWECLEDFSAVR--------
A0A5K6WAR5_E1B19K-      ----------------------------MEAWECLEDFFAVR--------
T1UG63_E1B19K-01        ----------------------------MEAWECLEDFSAVR--------
A0A6M5E4Y6_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
P03247_E1B19K-01        ----------------------------MEAWECLEDFSAVR--------
A0A3G8W3H5_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A516UYI9_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A8F9W8V2_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A3S9SND6_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A3Q9HJZ5_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A513TZR1_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A516UYM9_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7L4WG90_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7L4WIG2_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
J7I6T8_E1B19K-01        ----------------------------MEAWECLEDFSAVR--------
A0A7L4WK62_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7D0TN91_E1B19K-      ----------------MRRGLILVTSDLMEAWECLEDFSAVR--------
A0A3S9SNH4_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
Q6WQ37_E1B19K-01        ----------------------------MEAWECLEDFSAVR--------
Q6VGV8_E1B19K-01        ----------------------------MEAWECLEDFSAVR--------
A0A3Q9HJ54_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A3S9SSS2_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A3S9SNY0_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A2H4PJ75_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7D6TSN5_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
Q71BY5_E1B19K-04        ----------------------------MEAWECLEDFSAVR--------
A0A4P2SGW2_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7L4WIC2_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
A0A7L4WJT1_E1B19K-      ----------------------------MEAWECLEDFSAVR--------
D3JIR7_E1B19K-01        ----------------------------MELEAVLQSYQGVR--------
A0A076V686_E1B19K-      ----------------------------MELEAVLQSYQSIR--------
A0A5H2QAX5_E1B19K-      ----------------------------MELEAVLQSFQSVR--------
G1DE13_E1B19K-01        ----------------------------MELEAVLQSFQSVR--------
D0Z5R9_E1B19K-01        ----------------------------MELEAVLQSFQSVR--------
T1UEX7_E1B19K-01        ----------------------------MELEAVLQSFQSVR--------
A0A3G8WH01_E1B19K-      ----------------------------MELETVLQSFQSVR--------
P04492_E1B19K-01        ----------------------------MELETVLQSFQSVR--------
A0A2H5AI99_E1B19K-      ----------------------------MDLLKELRDFDVVR--------
A0A0M3TH31_E1B19K-      ----------------------------MDLLRLLSDYEVLR--------
M9YXY5_E1B19K-01        ----------------------------MDLLRLLSDYEVLR--------
M9YVF6_E1B19K-01        ----------------------------MDLLRLLSDYEVLR--------
A0MK43_E1B19K-01        ----------------------------MDLLGNLREFDVVR--------
A0A2H5AI21_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A0M5L3Y4_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
Q5C8R2_E1B19K-01        ----------------------------MDLLGDLREFGVVR--------
A0A0A1EUB2_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A0A1EUC8_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A2H5AI04_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A2H5AI72_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A2H5AIL3_E1B19K-      ----------------------------MDLLGDLREFGVVR--------
A0A2H4CJZ0_E1B19K-      ----------------------------MEFWSELQNYQSLR--------
H8PFZ1_E1B19K-01        ----------------------------MEYWSELQNYQSLR--------
A0A7U3RVU4_E1B19K-      ----------------------------MELWSELQSYENLR--------
A0A142G3J2_E1B19K-      ----------------------------MELWSELQSYQNLR--------
P10543_E1B19K-01        ----------------------------MELWSELQSYQNLR--------
A0A6M6AEV2_E1B19K-      ----------------------------MELWSELQSYQNLR--------
A0A7U3RWV6_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A1S6ELT2_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A3G4W995_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A898KBW7_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A482EVC6_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
P10544_E1B19K-01        ----------------------------MEFWSELQSYQSLR--------
W0S1G8_E1B19K-01        ----------------------------MEFWSELQSYQSLR--------
A0A3G8W407_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A898KBS1_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
F4ZCJ8_E1B19K-01        ----------------------------MEFWSELQSYQSLR--------
A0A6M6AES6_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
A0A8G1GLF6_E1B19K-      ----------------------------MEFWSELQSYQSLR--------
Q71BY5_E1B19K-01        ---------------------------VSQIFPD----------------
Q71BY5_E1B19K-02        ---------------------------VSQIFPD----------------
P03248_E1B19K-03        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
D3JIR7_E1B19K-02        ---------------GPSC----------------------------AAV
A0A5H2QAX5_E1B19K-      ---------------GPSC----------------------------AVV
T1UEX7_E1B19K-02        ---------------GPSC----------------------------AVV
R4HLE1_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
R4HLA0_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
J7ID56_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
Q5EY83_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
K7NG43_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTSSGQDRG
T1UIP3_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTSSGQDRG
Q2KRU2_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTSSGQDRG
Q2KS85_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTSSGQDRG
Q3ZKW2_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTSSGQDRG
R4HLJ6_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
R4HMC6_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
Q2Y0J3_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
I6LEP5_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
T1UF50_E1B19K-02        ---------------GPS---GGG---VADLFPELRRVLTRSTTSGQNRG
Q3ZL02_E1B19K-02        ---------------GPSSG-GGG---VADLSPELQRVLTGSTSTGRDRG
T1UFS4_E1B19K-02        ---------------GPSSG-GGG---VADLSPELQRVLTGSTSTGRDRG
W6EIX6_E1B19K-02        ---------------GPSSG-GGG---VADLSPELQRVLTGSTSTGRDRG
T1UE63_E1B19K-02        ---------------GPSSG-GGG---VADLSPELQRVLTGSTSTGRDRG
A0A7D0TLU2_E1B19K-      RRGEEQSLLYLQSGLDPR---KCHLVHIPQWPPELRRILTINEDGQGLKG
A0A4P2SGW2_E1B19K-      ---------------GPS---GMNVVQVAELYPELRRILTITEDGQGLKG
Q6VGV8_E1B19K-02        ---------------GPS---GMNVVQVAELYPELRRILTITEDGQGLKG
M0QU02_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTNGSIG--ARG
J7I6T8_E1B19K-02        ---------------GPS---GMNVVQVAELFPELRRILTINEDGQGLKG
T1UG63_E1B19K-02        ---------------GPS---GMNVVQVAELFPELRRILTINEDGQGLKG
A0A1P8C849_E1B19K-      ---------------GPSVGRGAGLNEVSSLYPELSKVLTSM-----ARG
T1UGY3_E1B19K-02        ---------------GPSVGRGAGLNEVSSLYPELSKVLTSM-----ARG
M0QUW8_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QVP5_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
M0QUS9_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
T1UKQ0_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
M0QV47_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
G1FBW4_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
F1DT57_E1B19K-02        ---------------GPSVGRGVGLNQVSSLYPELSKVLTSM-----ARG
E9P585_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
T1UKP8_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
W8CZB0_E1B19K-02        ---------------GPSVGRGAGLNQVASLYPELSKVLTTM-----ARG
T1ULJ8_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
M0QUB4_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
M0QVT4_E1B19K-02        ---------------GPSVGRGAGLNQVASLYPELSKVLTTM-----ARG
M0QVG6_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
T1UK99_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTTM-----ARG
M0QV87_E1B19K-02        ---------------GPSVGRGAGLSQVSSLYPELSKVLTSM-----ARG
T1UKV6_E1B19K-02        ---------------GPSVGRGVGLNQVSSLYPELSRVLTSM-----ARG
F8UFP5_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
T1UGT5_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
C5HDR2_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A3S6PYX7_E1B19K-      ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A097I4T0_E1B19K-      ---------------GPSAGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A384ZUM9_E1B19K-      ---------------GPSVGRGAGLNQVASLYPELSKVLTSM-----ARG
M0QUJ3_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
T1UHQ8_E1B19K-02        ---------------GPSVGRGAGLNQVASLYPELSKVLTTM-----ARG
T1UHH6_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
T1UHL7_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A075TSZ1_E1B19K-      ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QVK6_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QUN2_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
E1AI10_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A384ZUF2_E1B19K-      ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
C4P207_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QTS5_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
M0QV08_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
M0QU76_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QU41_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QVC7_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
A0A3Q9FFS0_E1B19K-      ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
T1UGX3_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
T1UHZ2_E1B19K-02        ---------------GPSVGRGAELNQVSSLYPELSKVLTSM-----ARG
A0A0G2UY10_E1B19K-      ---------------GPSVGRGAGLNQVSSLYPELSKVLTSM-----ARG
M0QUF3_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
G1FC01_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
G3CK71_E1B19K-02        ---------------GPSVGRGAGLNQVSSLYPELSRVLTSM-----ARG
Q5GFC7_E1B19K-03        ---------------GPS---GGG---VADLFPELHRVLTRS-SSGRERG
I6LEP5_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        ---------------GPSGGGGGG---VADLFPELRRVLTRSTTSGRDRG
P04492_E1B19K-02        ---------------QVQEGHVLERGEGPSCADD-------------RDK
A0MK43_E1B19K-02        ---------------GPSSGRLGAEDDPEEGTSG-------------GAR
A0A482EVC6_E1B19K-      ---------------GSSNG-IVTEPDPEEGTSS-------------GQR
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------NPFQQGLPAGF-------
A0A0M4NHE0_E1B19K-      --------------------------------RLVELCSNRSSWFGRFLF
H9AAK5_E1B19K-01        --------------------------------RLVELCSNRSSWFGRFLF
G0ZAH2_E1B19K-01        --------------------------------QVLQQASKRTGGWSRWLL
A0A3Q9HK78_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A3S9SPV1_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A1W5PVU4_E1B19K-      --------------------------------RVLEEASEDTSVWWRRLF
A0A0M3TH18_E1B19K-      --------------------------------RVLEEASEDTSVWWRKLF
A0A097IW62_E1B19K-      --------------------------------KVVEEASEQTSGWWRKLF
A0A0A1EUE4_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AI40_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AID8_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AII9_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIL0_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIN5_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIS9_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIT6_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIU0_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AIC5_E1B19K-      --------------------------------RLLELASDKTSRLWRFWF
A0A0G2UY10_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
X4Y9D2_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
C5HDR2_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QVC7_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A3S6PYX7_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
Q4KSL0_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A1P8C849_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
T1UGY3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
H5T740_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A1J0MS84_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
A0A097I4T0_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
E5RWD9_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QU76_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A7R6T9I9_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
D3GBW3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUF3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QU41_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
F1DT57_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
B2VQE3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UHZ2_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A3Q9FFS0_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
T1ULJ8_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
E9P585_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UHL7_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A075TSZ1_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
T1UHH6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UKP8_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A291B0H2_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
B9A5Q1_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUB4_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUJ3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUN2_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
C4P207_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
E1CIM6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
D4N3H6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QVK6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QVT4_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
E1AI10_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
H0PPE7_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A3G8WIY5_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
Q9YL99_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
A0A384ZUF2_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
A0A384ZUM9_E1B19K-      --------------------------------RLVEDSSDGCSGFWRHWF
T1UHQ8_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
W8VNG2_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
F8UFP5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QV87_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QU02_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UKV6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QV47_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUW8_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
E1CIJ0_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QVG6_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
X4YVU5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QUS9_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
G1FBW4_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QVP5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UKQ0_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
W8CZB0_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
G1FC01_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
G3CK71_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UGT5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UK99_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QTS5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
M0QV08_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
G9JUV5_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
T1UGX3_E1B19K-01        --------------------------------RLVEDSSDGCSGFWRHWF
Q7T951_E1B19K-01        --------------------------------QLLESASDGVSGFWRFWF
T1UE63_E1B19K-01        --------------------------------QLLESASDGVSGFWRFWF
Q8B8U7_E1B19K-01        --------------------------------QLLENASDGVSGFWRFWF
Q5UW22_E1B19K-01        --------------------------------QLLENASDGVSGFWRFWF
W6EIX6_E1B19K-01        --------------------------------QLLEDASDGVSGFWRFWF
Q3ZL02_E1B19K-01        --------------------------------QLLEDASDGVSGFWRFWF
T1UFS4_E1B19K-01        --------------------------------QLLEDASDGVSGFWRFWF
A0A7G5F9T0_E1B19K-      --------------------------------QLLENASDGVSGFWRFWF
C7SRS7_E1B19K-01        --------------------------------QLLENASDGVSGFWRFWF
D2DM83_E1B19K-01        --------------------------------QLLENASDGVSGFWRFWF
T2CI10_E1B19K-01        --------------------------------QLLENASDGVSGLWRFWF
A0A0K0PX99_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
A0A0K0PX35_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
A0A8B0L9Y2_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
J7ID56_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
A0A6M6AA96_E1B19K-      --------------------------------LLIENASDGVSGLWRFWF
A0A220VZ73_E1B19K-      --------------------------------LLLENASDGVSGLWRFCF
A0A8B0LD36_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
A0A8B0LBX6_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
R4HLE1_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
R4HMC6_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
P03248_E1B19K-02        --------------------------------LLLENASDGVSGLWRFWF
Q2KS85_E1B19K-01        --------------------------------LLLENASDGVSGFWRFWF
Q3ZKW2_E1B19K-01        --------------------------------LLLENASDGVSGFWRFWF
K7NG43_E1B19K-01        --------------------------------LLLENASDGVSGFWRFWF
Q2KRU2_E1B19K-01        --------------------------------LLLENASDGVSGFWRFWF
A0A8B0LCV0_E1B19K-      --------------------------------LLLENASDGVSGFWRFWF
T1UIP3_E1B19K-01        --------------------------------LLLENASDGVSGFWRFWF
R4HLJ6_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
R4HLA0_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
Q2Y0J3_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
A0A5J6CTQ0_E1B19K-      --------------------------------LLLENASDGVSGLWRFWF
Q5EY83_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
I6LEP5_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
T1UF50_E1B19K-01        --------------------------------LLLENASDGVSGLWRFWF
Q6QPF3_E1B19K-01        --------------------------------QLLENSSEGVSYLWRFCF
Q6QPB7_E1B19K-01        --------------------------------QLLENSSEGVSYLWRFCF
Q6QPI9_E1B19K-01        --------------------------------QLLENSSEGVSYLWRFCF
P10406_E1B19K-01        --------------------------------QLLENASNGVSHLWRFCF
Q5GFC7_E1B19K-02        --------------------------------QLLENASNGVSYLWRFCF
A0A2R3WN62_E1B19K-      --------------------------------QLLENASNGVSYLWRFCF
A0A3G8W6L2_E1B19K-      --------------------------------QLLENASNGVSYLWRFCF
Q5GFC7_E1B19K-01        --------------------------------QLLENASNGVSYLWRFCF
G9G841_E1B19K-01        --------------------------------QLLENASNGVSHLWRFCF
Q8UY91_E1B19K-01        --------------------------------QLLENASNGVSYLWRFCF
A0A1L3INW0_E1B19K-      --------------------------------QLLEEASNSTSYCWRFLF
P06501_E1B19K-01        --------------------------------RLLELCSNRTSFLWRWLF
A0A0M4N3Z1_E1B19K-      --------------------------------RLLELCSNRTSFLWRWLF
Q8B6X5_E1B19K-01        --------------------------------RLLELCSNRTSFLWRWLF
H9AAD9_E1B19K-01        --------------------------------RLVELCSNRSSWFGRFLF
H9AAH3_E1B19K-01        --------------------------------RLVELCSNRSSWFGRFLF
H9AAA8_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
M9YVA3_E1B19K-01        --------------------------------CLLELCSNRDPWWKRLLF
F2WTJ7_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
F2WTM9_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
H9AA76_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
A0A1C8EG46_E1B19K-      --------------------------------CLLELCSNRASWWKRLLF
H9AAN8_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
H9AAS0_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
H9AAV3_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
H9AAY5_E1B19K-01        --------------------------------CLLELCSNRASWWKRLLF
F6KST6_E1B19K-01        --------------------------------RLLEEASDRTSYFWRFLC
A0A7L4WGT1_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A3S9SP19_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A291P1B2_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A5K6WAR5_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
T1UG63_E1B19K-01        --------------------------------NLLEQSSNSTSWFWRFLW
A0A6M5E4Y6_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
P03247_E1B19K-01        --------------------------------NLLEQSSNSTSWFWRFLW
A0A3G8W3H5_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A516UYI9_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A8F9W8V2_E1B19K-      --------------------------------NLLKQSSNSTSWFWRFLW
A0A3S9SND6_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A3Q9HJZ5_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A513TZR1_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A516UYM9_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7L4WG90_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7L4WIG2_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
J7I6T8_E1B19K-01        --------------------------------NLLEQSSNSTSWFWRFLW
A0A7L4WK62_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7D0TN91_E1B19K-      --------------------------------NLLEQSSNSTSWFWRVLW
A0A3S9SNH4_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
Q6WQ37_E1B19K-01        --------------------------------NLLEQSSNSTSWFWRFLW
Q6VGV8_E1B19K-01        --------------------------------NLLEQSSNSTSWFWRFLW
A0A3Q9HJ54_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A3S9SSS2_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A3S9SNY0_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A2H4PJ75_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7D6TSN5_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
Q71BY5_E1B19K-04        --------------------------------NLLEQSSNSTSWFWRFLW
A0A4P2SGW2_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7L4WIC2_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
A0A7L4WJT1_E1B19K-      --------------------------------NLLEQSSNSTSWFWRFLW
D3JIR7_E1B19K-01        --------------------------------QLLQYTSKNTSGFWRYLF
A0A076V686_E1B19K-      --------------------------------QLLQHTSRNTSGFWRYLF
A0A5H2QAX5_E1B19K-      --------------------------------QLLQYTSKNTSGFWRYLF
G1DE13_E1B19K-01        --------------------------------QLLQYTSKNTSGFWRYLF
D0Z5R9_E1B19K-01        --------------------------------QLLQYTSKNTSGFWRYLF
T1UEX7_E1B19K-01        --------------------------------QLLQYTSKNTSGFWRYLF
A0A3G8WH01_E1B19K-      --------------------------------QLLQYTSKNTSGFWRYLF
P04492_E1B19K-01        --------------------------------QLLQYTSKNTSGFWRYLF
A0A2H5AI99_E1B19K-      --------------------------------QLLESASDKTSKFWRFCF
A0A0M3TH31_E1B19K-      --------------------------------KLLETACEKTSSCWRFFF
M9YXY5_E1B19K-01        --------------------------------KLLETACEKTSSCWRFFF
M9YVF6_E1B19K-01        --------------------------------KLLETACEKNRSCWRFFF
A0MK43_E1B19K-01        --------------------------------RLLELASDKTSRLWRFWF
A0A2H5AI21_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A0M5L3Y4_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
Q5C8R2_E1B19K-01        --------------------------------RLLELASDRTSKFWRFCF
A0A0A1EUB2_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A0A1EUC8_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A2H5AI04_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A2H5AI72_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A2H5AIL3_E1B19K-      --------------------------------RLLELASDRTSKFWRFCF
A0A2H4CJZ0_E1B19K-      --------------------------------HLLELASARTSTCWRFCF
H8PFZ1_E1B19K-01        --------------------------------RLLELASARTSTCWRFCF
A0A7U3RVU4_E1B19K-      --------------------------------RLLELASARTSSCWRILF
A0A142G3J2_E1B19K-      --------------------------------RLLELASARTSSCWRILF
P10543_E1B19K-01        --------------------------------RLLELASARTSSCWRILF
A0A6M6AEV2_E1B19K-      --------------------------------RLLELASARTSSCWRILF
A0A7U3RWV6_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A1S6ELT2_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A3G4W995_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A898KBW7_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A482EVC6_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
P10544_E1B19K-01        --------------------------------RLLELASARTSSCWRFIF
W0S1G8_E1B19K-01        --------------------------------RLLELASARTSSCWRFIF
A0A3G8W407_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A898KBS1_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
F4ZCJ8_E1B19K-01        --------------------------------RLLELASARTSSCWRFIF
A0A6M6AES6_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
A0A8G1GLF6_E1B19K-      --------------------------------RLLELASARTSSCWRFIF
Q71BY5_E1B19K-01        ---------------------------------SVMLAAQEGIDLLTFPP
Q71BY5_E1B19K-02        ---------------------------------SVMLAAQEGIDLLTFPP
P03248_E1B19K-03        IKRERNPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
D3JIR7_E1B19K-02        NIKRE----RETVLSRLAVNIMSRPRLETVYWQELQNEFQQGDMHLQYKY
A0A5H2QAX5_E1B19K-      KKRERKESLKEAVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKY
T1UEX7_E1B19K-02        KKRERKESLKETVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKY
R4HLE1_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
R4HLA0_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
J7ID56_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q5EY83_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
K7NG43_E1B19K-02        IKRERNPS-GNNLRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
T1UIP3_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q2KRU2_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q2KS85_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q3ZKW2_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
R4HLJ6_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
R4HMC6_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q2Y0J3_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
I6LEP5_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
T1UF50_E1B19K-02        IKRERNPS-GNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKY
Q3ZL02_E1B19K-02        VKRERASS-GTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
T1UFS4_E1B19K-02        VKRERASS-GTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
W6EIX6_E1B19K-02        VKRERACS-GTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
T1UE63_E1B19K-02        VKRERASS-GTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
A0A7D0TLU2_E1B19K-      VKRERGASEATEEVRNLTFSFKISPLAEPVSGQQIKDNCANELDLLAQKY
A0A4P2SGW2_E1B19K-      VKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKY
Q6VGV8_E1B19K-02        VKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKY
M0QU02_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPECITWHELQMECRDEVGLMQDKY
J7I6T8_E1B19K-02        VKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKY
T1UG63_E1B19K-02        VKRERGASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKY
A0A1P8C849_E1B19K-      VKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKY
T1UGY3_E1B19K-02        VKRERSDGGNTGLMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QUW8_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
M0QVP5_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
M0QUS9_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
T1UKQ0_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
M0QV47_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
G1FBW4_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKY
F1DT57_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKY
E9P585_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKY
T1UKP8_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
W8CZB0_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
T1ULJ8_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QUB4_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QVT4_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QVG6_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
T1UK99_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QV87_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKY
T1UKV6_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKY
F8UFP5_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKY
T1UGT5_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKY
C5HDR2_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
A0A3S6PYX7_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
A0A097I4T0_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
A0A384ZUM9_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
M0QUJ3_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEIGLMQDKY
T1UHQ8_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
T1UHH6_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKY
T1UHL7_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
A0A075TSZ1_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
M0QVK6_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKY
M0QUN2_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKY
E1AI10_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKY
A0A384ZUF2_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKY
C4P207_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKY
M0QTS5_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
M0QV08_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
M0QU76_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
M0QU41_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
M0QVC7_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
A0A3Q9FFS0_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
T1UGX3_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
T1UHZ2_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKY
A0A0G2UY10_E1B19K-      VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
M0QUF3_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKY
G1FC01_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
G3CK71_E1B19K-02        VKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKY
Q5GFC7_E1B19K-03        IKRERH-DE-TNHRIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERF
I6LEP5_E1B19K-03        ---------------------MSRRRPETVWWHEVQSEGRDEVSILQEKY
T2CI10_E1B19K-02        IKRERNPSG-TNPRSELALSLMSRRRPETIWWHEVQNEGRDEVSILQEKY
P04492_E1B19K-02        -QEKKESLKEAAVLSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKY
A0MK43_E1B19K-02        -KKQKTEPEPRNFLNELTVSLMNRQRPETVFWAELEDEFKKGELNLLYKY
A0A482EVC6_E1B19K-      GEKRKLENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKY
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        -------------LSSSFVENMEV-----PAPECNLRLLAGTAARHSEDP
A0A0M4NHE0_E1B19K-      GSTLCRVVR---QVKEEYQSEFEH-----ILSNCPG-LFVSLDLGHHTVF
H9AAK5_E1B19K-01        GSTLCRVVR---QVKEEYQSEFEH-----ILSNCPG-LFVSLDLGHHTVF
G0ZAH2_E1B19K-01        GNQLVRTVA---QVKTDYSEHFEQ-----LLQEQNRLLLNNLELGHTRAL
A0A3Q9HK78_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SPV1_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A1W5PVU4_E1B19K-      GCRVSQLVV---QAKVEYKEEFEK-----LFSEVPG-LVDSLNFCHHAFF
A0A0M3TH18_E1B19K-      GCRVSQLVV---QAKVEYKEEFEK-----LFSEVPG-LVDSLNFCHHAFF
A0A097IW62_E1B19K-      GCRLSCLVV---QAKFEYREEFER-----LFAEVPG-LLESLNFCHHAVF
A0A0A1EUE4_E1B19K-      GSTLSSVVY---RVKKEQEGQFSR-----LLADIPG-VFVALDLGHHSLF
A0A2H5AI40_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AID8_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AII9_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIL0_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIN5_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIS9_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIT6_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIU0_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A2H5AIC5_E1B19K-      GSTLSSVVY---RVKREQEAQFAR-----LLAETPG-VLVALDLGHHSLF
A0A0G2UY10_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
X4Y9D2_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
C5HDR2_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QVC7_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A3S6PYX7_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
Q4KSL0_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A1P8C849_E1B19K-      GTPLSRLVY---TVKKDYSEEFEN-----LFADCSG-LLDSLNFGHQSLF
T1UGY3_E1B19K-01        GTPLSRLVY---TVKKDYSEEFEN-----LFADCSG-LLDSLNFGHQSLF
H5T740_E1B19K-01        GTPLARLVY---TVKKDYQDEFEN-----LFADCSG-LLDSLNLGHQALF
A0A1J0MS84_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A097I4T0_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
E5RWD9_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QU76_E1B19K-01        GTPLSRLVY---TVKKDYNEEIEN-----LFADCSG-LLDSLNLGHQSLF
A0A7R6T9I9_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
D3GBW3_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QUF3_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QU41_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
F1DT57_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
B2VQE3_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
T1UHZ2_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A3Q9FFS0_E1B19K-      GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
T1ULJ8_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQALF
E9P585_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
T1UHL7_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A075TSZ1_E1B19K-      GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
T1UHH6_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
T1UKP8_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
A0A291B0H2_E1B19K-      GTPLSRLVY---TVKKDYSEEFEN-----LFSDCSG-LLDSLNLGHQSLF
B9A5Q1_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QUB4_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QUJ3_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
M0QUN2_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
C4P207_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
E1CIM6_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
D4N3H6_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QVK6_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
M0QVT4_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
E1AI10_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
H0PPE7_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
A0A3G8WIY5_E1B19K-      GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
Q9YL99_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
A0A384ZUF2_E1B19K-      GTPLSRLVY---TVKKDYKEEFEN-----IFADCSG-LLDSLNLGHQSLF
A0A384ZUM9_E1B19K-      GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQSLF
T1UHQ8_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNLGHQSLF
W8VNG2_E1B19K-01        GTPLSRLVY---TVKKDYSEEFEN-----LFSDCSG-LLDSLNFGHQSLF
F8UFP5_E1B19K-01        GTPLSRLVY---TVKKDYSEEFEN-----LFSDCSG-LLDSLNFGHQSLF
M0QV87_E1B19K-01        GTPLSRLVY---TVKKDYSEEFEN-----LFSDCSG-LLDSLNFGHQSLF
M0QU02_E1B19K-01        GTPLSRLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNFGHQSLF
T1UKV6_E1B19K-01        GTPLSRLVY---TVKKDYSEEFEN-----LFSDCSG-LLDSLNFGHQSLF
M0QV47_E1B19K-01        GTPLARLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
M0QUW8_E1B19K-01        GTPLARLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
E1CIJ0_E1B19K-01        GTPLARLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
M0QVG6_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFVDCSG-LLDSLNLGHQALF
X4YVU5_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFVDCSG-LLDSLNLGHQALF
M0QUS9_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNLGHQALF
G1FBW4_E1B19K-01        GSPLSRLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
M0QVP5_E1B19K-01        GTPLSRLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
T1UKQ0_E1B19K-01        GSPLSRLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNLGHQALF
W8CZB0_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
G1FC01_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
G3CK71_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
T1UGT5_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
T1UK99_E1B19K-01        GTPLSRLVY---TVKKDYQEEFEN-----LFADCSG-LLDSLNFGHQSLF
M0QTS5_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
M0QV08_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
G9JUV5_E1B19K-01        GTPLSRLVY---TVKKDYNEEFEN-----LFADCSG-LLDSLNFGHQSLF
T1UGX3_E1B19K-01        GTPLSRLVY---TVKKDYKEEFEN-----LFADCSG-LLDSLNFGHQSLF
Q7T951_E1B19K-01        ASELARVVF---RIKQDYKQEFEK-----LLVDCPG-LFEALNLGHQVHF
T1UE63_E1B19K-01        ASELARVVF---RIKQDYKQEFEK-----LLVDCPG-LFEALNLGHQVHF
Q8B8U7_E1B19K-01        ASELARVVF---RIKQDYNQEFEK-----LLVDCPG-LFEALNLGHQVHF
Q5UW22_E1B19K-01        ASELARVVF---RIKQDYKQEFEK-----LLVDCPG-LFEALNLGHQVHF
W6EIX6_E1B19K-01        ASELARVVF---RIKQDYKEEFEK-----LLLDCPG-LFEALNLGHQVHF
Q3ZL02_E1B19K-01        ASELARVVF---RIKQDYKEEFEK-----LLVDCPG-LFEALNLGHQVHF
T1UFS4_E1B19K-01        ASELARVVF---RIKQDYKEEFEK-----LLVDCPG-LFEALNLGHQVHF
A0A7G5F9T0_E1B19K-      ASELARVVF---RIKQDYKEEFEK-----LLVDCPG-LFEALNLGHQVHF
C7SRS7_E1B19K-01        ASEIARVVF---RIKQDYKEEFEK-----LLVDCPG-LFEALNLGHQVHF
D2DM83_E1B19K-01        ASELARVVF---RIKQDYKEEFEK-----LLVDCPG-LFEALNLGHQVHF
T2CI10_E1B19K-01        GGDLARLVF---RIKQDYRQEFEK-----LLDDCPG-LFEALNLGHQAHF
A0A0K0PX99_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A0K0PX35_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A8B0L9Y2_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
J7ID56_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A6M6AA96_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A220VZ73_E1B19K-      GGDLARLVF---RIKQDYSVEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A8B0LD36_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A8B0LBX6_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
R4HLE1_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDNSPG-LFEALNLGHQAHF
R4HMC6_E1B19K-01        GGDLARLVF---RIKQDYSVEFEK-----LLDDSPG-LFEALNLGHQAHF
P03248_E1B19K-02        GGDLARLVF---RIKQDYSVEFEK-----LLDDSPG-LFEALNLGHQAHF
Q2KS85_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
Q3ZKW2_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
K7NG43_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
Q2KRU2_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A8B0LCV0_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
T1UIP3_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
R4HLJ6_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
R4HLA0_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
Q2Y0J3_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
A0A5J6CTQ0_E1B19K-      GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
Q5EY83_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDIPG-LFEALNLGHQAHF
I6LEP5_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHRAHF
T1UF50_E1B19K-01        GGDLARLVF---RIKQDYREEFEK-----LLDDSPG-LFEALNLGHQAHF
Q6QPF3_E1B19K-01        GGPLAKLVY---RAKQDYKEQFED-----ILRECPG-IFDSLNLGHQSHF
Q6QPB7_E1B19K-01        GGPLAKLVY---RAKQDYKDQFED-----ILRECPG-IFDSLNLGHQSHF
Q6QPI9_E1B19K-01        GGPLAKLVY---RAKQDYKDQFED-----ILRECPG-IFDSLNLGHQSHF
P10406_E1B19K-01        GGDLAKLVY---RAKQDYREQFED-----ILRECPS-LFDALNLGHQSHF
Q5GFC7_E1B19K-02        GGDLAKLVY---RAKQDYREQFED-----ILRECPG-LFDALNLGHQSHF
A0A2R3WN62_E1B19K-      GGDLAKLVY---RAKQDYREQFED-----ILRECPG-LFDALNLGHQSHF
A0A3G8W6L2_E1B19K-      GGDLAKLVY---RTKQDYKEQFDD-----ILKECPG-LFDALNLGHQSHF
Q5GFC7_E1B19K-01        GGDLAKLVY---RAKQDYREQFED-----ILRECPG-LFDALNLGHQSHF
G9G841_E1B19K-01        GGDLAKLVY---RAKQDYSEQFEV-----ILRECPG-LFDALNLGHQTHF
Q8UY91_E1B19K-01        GGDLARLVY---RAKQDYSEQFEV-----ILRECSG-LFDALNLGHQSHF
A0A1L3INW0_E1B19K-      GSPLGRFLY---RVKKDHQEEFDQ-----LIGLFPT-IFESLNLGHKTLL
P06501_E1B19K-01        GTPLSRLVR---QVKLEYEKDFER-----ILDQCPG-VFESLELGYHKVF
A0A0M4N3Z1_E1B19K-      GTPLSRLVR---QVKLEYEKDFER-----ILDQCPG-VFESLELGYHKVF
Q8B6X5_E1B19K-01        GTPLSRLVR---QVKLEYEKDFER-----ILDQCPG-VFESLELGYHKVF
H9AAD9_E1B19K-01        GSTLCRVVR---QVKEEYQSEFEH-----ILSNCPG-LFVSLDLGHHTVF
H9AAH3_E1B19K-01        GSTLCRVVR---QVKEEYQSEFEH-----ILSNCPG-LFVSLDLGHHTVF
H9AAA8_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
M9YVA3_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
F2WTJ7_E1B19K-01        GTSLCRLVR---QVKEEYESEFEH-----ILSTCQG-LFESLELGHHTVF
F2WTM9_E1B19K-01        GTSLCRLVR---QVKEEYESEFEH-----ILSTCQG-LFESLELGHHTVF
H9AA76_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
A0A1C8EG46_E1B19K-      GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
H9AAN8_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
H9AAS0_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
H9AAV3_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
H9AAY5_E1B19K-01        GTSLCRLVR---QVKEEYQSEFEH-----ILSTCQG-LFESLELGHHTVF
F6KST6_E1B19K-01        GSPLSRFLN---RVKREHRAEFDE-----LLEHLPG-LFDSLNLGHRVLL
A0A7L4WGT1_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SP19_E1B19K-      GSSQAKLVC---RIKEDYKWEFED-----LLKSCGE-LFDSLNLGHQALF
A0A291P1B2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A5K6WAR5_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
T1UG63_E1B19K-01        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A6M5E4Y6_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
P03247_E1B19K-01        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3G8W3H5_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A516UYI9_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A8F9W8V2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SND6_E1B19K-      GSSQAKLVC---RVKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3Q9HJZ5_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A513TZR1_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A516UYM9_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7L4WG90_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7L4WIG2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
J7I6T8_E1B19K-01        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7L4WK62_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7D0TN91_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SNH4_E1B19K-      GSSQAKLVC---RVKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
Q6WQ37_E1B19K-01        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALL
Q6VGV8_E1B19K-01        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3Q9HJ54_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SSS2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A3S9SNY0_E1B19K-      GSCQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A2H4PJ75_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7D6TSN5_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
Q71BY5_E1B19K-04        GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A4P2SGW2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7L4WIC2_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
A0A7L4WJT1_E1B19K-      GSSQAKLVC---RIKEDYKWEFEE-----LLKSCGE-LFDSLNLGHQALF
D3JIR7_E1B19K-01        GSTLCKVVH---RVKEDYRKEFEN-----ILAGCPG-LLASLDLCHHSIF
A0A076V686_E1B19K-      GSTLSKVVH---RVKEDYRNEFEN-----ILAGCPG-LLASLDLCHHSIF
A0A5H2QAX5_E1B19K-      GSTLSKVVH---RVKEDYREEFEN-----ILADCPG-LLASLDLCHHSVF
G1DE13_E1B19K-01        GSTFSKVVH---RVKEDYREEFEN-----ILTDCPG-LLASLDLCHHSVF
D0Z5R9_E1B19K-01        GSTLSKVVH---RVKEDYREEFEN-----ILADCPG-LLASLDLCHHSVF
T1UEX7_E1B19K-01        GSTLSKVVH---RVKEDYREEFEN-----ILADCPG-LLASLDLCHHSVF
A0A3G8WH01_E1B19K-      GSTLSKVVN---RVKEDYREEFEN-----ILADCPG-LLASLDLCHHLVF
P04492_E1B19K-01        GSTLSKVVN---RVKEDYREEFEN-----ILADCPG-LLASLDLCYHLVF
A0A2H5AI99_E1B19K-      GSTLSNVVY---RVKKEQAEQFSR-----LLAEIPG-VFVALDLGHHALF
A0A0M3TH31_E1B19K-      GSTLSNVVH---RVKREHSEEFSR-----LVADVPG-LFVSLDLGHHSYF
M9YXY5_E1B19K-01        GSTLSNVVH---RVKREHSEEFSR-----LVADVPG-LFVSLDLGHHSYF
M9YVF6_E1B19K-01        GSTLSNVVH---RVKREHSEEFSR-----LVADVPG-LFVSLDLGHHSYF
A0MK43_E1B19K-01        GSTLSSVVY---RVKREQEAQFAR-----LLADTPG-VFVALDLGHHSLF
A0A2H5AI21_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A0M5L3Y4_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
Q5C8R2_E1B19K-01        GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A0A1EUB2_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A0A1EUC8_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A2H5AI04_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A2H5AI72_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A2H5AIL3_E1B19K-      GSTLSNVLY---RVKKEQETQFAR-----LLADTPG-VFVALDLGHHSLF
A0A2H4CJZ0_E1B19K-      GSTLSNVVY---RVKQEYSSRFSE-----LLARYPA-VFASLDLGHHVYF
H8PFZ1_E1B19K-01        GSTLSNVVY---RVKQEYSSRFSE-----LLARYPA-VFVSLDLGHHVYF
A0A7U3RVU4_E1B19K-      GSTLANVIY---RAKEEYSSRFAD-----LLSHNPG-IFASLNLGHHSFF
A0A142G3J2_E1B19K-      GSTLANVIY---RAKEEYSSRFAD-----LLSHNPG-IFASLNLGHHSFF
P10543_E1B19K-01        GSTLTNVIY---RAKEEYSSRFAD-----LLSHNPG-IFASLNLGHHSFF
A0A6M6AEV2_E1B19K-      GSTLTNVIY---RAKEEYSSRFAD-----LLSHNPG-IFASLNLGHHSFF
A0A7U3RWV6_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A1S6ELT2_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A3G4W995_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A898KBW7_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A482EVC6_E1B19K-      GSTLTNVIY---RAKEDYSSQFAE-----LLSFNPG-IFASLNLGHHSFF
P10544_E1B19K-01        GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
W0S1G8_E1B19K-01        GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A3G8W407_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A898KBS1_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
F4ZCJ8_E1B19K-01        GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A6M6AES6_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
A0A8G1GLF6_E1B19K-      GSTLTNVIY---RAKEDYSSRFAE-----LLSFNPG-IFASLNLGHHSFF
Q71BY5_E1B19K-01        APGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDE
Q71BY5_E1B19K-02        APGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDE
P03248_E1B19K-03        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
D3JIR7_E1B19K-02        GFEQLKTHWL--EPWEDIESAIKTFAKLALRPDRSYKISKTITIASYAYI
A0A5H2QAX5_E1B19K-      SFEQLKTHWL--EPWEDLECAIKAFAKVALRPDCTYKISKTVTITSCTYI
T1UEX7_E1B19K-02        SFEQLKTHWL--EPWEDLECAIKAFAKVALRPDCTYKISKTVTITSCTYI
R4HLE1_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
R4HLA0_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
J7ID56_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q5EY83_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
K7NG43_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
T1UIP3_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q2KRU2_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q2KS85_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q3ZKW2_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
R4HLJ6_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
R4HMC6_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q2Y0J3_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
I6LEP5_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
T1UF50_E1B19K-02        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
Q3ZL02_E1B19K-02        SLEQVKTCWL--EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYI
T1UFS4_E1B19K-02        SLEQVKTCWL--EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYI
W6EIX6_E1B19K-02        SLEQVKTCWL--EPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYI
T1UE63_E1B19K-02        SLEQVKTCWL--EPEDDWEVAIKNYAKIALRPDKQYKISRRINIRNACYI
A0A7D0TLU2_E1B19K-      SIEQLTTYWL--QPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYI
A0A4P2SGW2_E1B19K-      SIEQLTTYWL--QPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYI
Q6VGV8_E1B19K-02        SIEQLTTYWL--QPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYI
M0QU02_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYI
J7I6T8_E1B19K-02        SIEQLTTYWL--QPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYI
T1UG63_E1B19K-02        SIEQLTTYWL--QPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYI
A0A1P8C849_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYI
T1UGY3_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYI
M0QUW8_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTINIRHACYI
M0QVP5_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYI
M0QUS9_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
T1UKQ0_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
M0QV47_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
G1FBW4_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
F1DT57_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
E9P585_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
T1UKP8_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYI
W8CZB0_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYI
T1ULJ8_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYI
M0QUB4_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYI
M0QVT4_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYI
M0QVG6_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYKVTKTVNIRHACYI
T1UK99_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYI
M0QV87_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
T1UKV6_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
F8UFP5_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
T1UGT5_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
C5HDR2_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYI
A0A3S6PYX7_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYI
A0A097I4T0_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYI
A0A384ZUM9_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
M0QUJ3_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
T1UHQ8_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
T1UHH6_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
T1UHL7_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
A0A075TSZ1_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
M0QVK6_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
M0QUN2_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
E1AI10_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
A0A384ZUF2_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
C4P207_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
M0QTS5_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYI
M0QV08_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYI
M0QU76_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
M0QU41_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
M0QVC7_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
A0A3Q9FFS0_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
T1UGX3_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYI
T1UHZ2_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYI
A0A0G2UY10_E1B19K-      GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
M0QUF3_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
G1FC01_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
G3CK71_E1B19K-02        GLEQIKTHWL--NPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYI
Q5GFC7_E1B19K-03        SLEQVKTCWL--EPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYI
I6LEP5_E1B19K-03        SLEQLKTCWL--EPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYI
T2CI10_E1B19K-02        SLEQVKTCWL--EPEDDWEVAIRNYAKIALRPDKLYRITKRINIRNACYI
P04492_E1B19K-02        SFEQLKTHWL--EPWEDMECAIKAFAKLALRPDCSYRITKTVTITSCAYI
A0MK43_E1B19K-02        GFEQLKTHWL--EPWEDMEMALDTFAKVALRPDKVYTIRRTVNIKKSVYV
A0A482EVC6_E1B19K-      GFEQLKTHWM--EPWEDWELALNMFAKVALRPDTIYTIKKTVNIRKCAYV
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        E-------------------------------------------------
A0A0M4NHE0_E1B19K-      Q-------------------------------------------------
H9AAK5_E1B19K-01        Q-------------------------------------------------
G0ZAH2_E1B19K-01        N-------------------------------------------------
A0A3Q9HK78_E1B19K-      Q-------------------------------------------------
A0A3S9SPV1_E1B19K-      Q-------------------------------------------------
A0A1W5PVU4_E1B19K-      Y-------------------------------------------------
A0A0M3TH18_E1B19K-      Y-------------------------------------------------
A0A097IW62_E1B19K-      Y-------------------------------------------------
A0A0A1EUE4_E1B19K-      Q-------------------------------------------------
A0A2H5AI40_E1B19K-      Q-------------------------------------------------
A0A2H5AID8_E1B19K-      Q-------------------------------------------------
A0A2H5AII9_E1B19K-      Q-------------------------------------------------
A0A2H5AIL0_E1B19K-      Q-------------------------------------------------
A0A2H5AIN5_E1B19K-      Q-------------------------------------------------
A0A2H5AIS9_E1B19K-      Q-------------------------------------------------
A0A2H5AIT6_E1B19K-      Q-------------------------------------------------
A0A2H5AIU0_E1B19K-      Q-------------------------------------------------
A0A2H5AIC5_E1B19K-      Q-------------------------------------------------
A0A0G2UY10_E1B19K-      Q-------------------------------------------------
X4Y9D2_E1B19K-01        Q-------------------------------------------------
C5HDR2_E1B19K-01        Q-------------------------------------------------
M0QVC7_E1B19K-01        Q-------------------------------------------------
A0A3S6PYX7_E1B19K-      Q-------------------------------------------------
Q4KSL0_E1B19K-01        Q-------------------------------------------------
A0A1P8C849_E1B19K-      Q-------------------------------------------------
T1UGY3_E1B19K-01        Q-------------------------------------------------
H5T740_E1B19K-01        Q-------------------------------------------------
A0A1J0MS84_E1B19K-      Q-------------------------------------------------
A0A097I4T0_E1B19K-      Q-------------------------------------------------
E5RWD9_E1B19K-01        Q-------------------------------------------------
M0QU76_E1B19K-01        Q-------------------------------------------------
A0A7R6T9I9_E1B19K-      Q-------------------------------------------------
D3GBW3_E1B19K-01        Q-------------------------------------------------
M0QUF3_E1B19K-01        Q-------------------------------------------------
M0QU41_E1B19K-01        Q-------------------------------------------------
F1DT57_E1B19K-01        Q-------------------------------------------------
B2VQE3_E1B19K-01        Q-------------------------------------------------
T1UHZ2_E1B19K-01        Q-------------------------------------------------
A0A3Q9FFS0_E1B19K-      Q-------------------------------------------------
T1ULJ8_E1B19K-01        Q-------------------------------------------------
E9P585_E1B19K-01        Q-------------------------------------------------
T1UHL7_E1B19K-01        Q-------------------------------------------------
A0A075TSZ1_E1B19K-      Q-------------------------------------------------
T1UHH6_E1B19K-01        Q-------------------------------------------------
T1UKP8_E1B19K-01        Q-------------------------------------------------
A0A291B0H2_E1B19K-      Q-------------------------------------------------
B9A5Q1_E1B19K-01        Q-------------------------------------------------
M0QUB4_E1B19K-01        Q-------------------------------------------------
M0QUJ3_E1B19K-01        Q-------------------------------------------------
M0QUN2_E1B19K-01        Q-------------------------------------------------
C4P207_E1B19K-01        Q-------------------------------------------------
E1CIM6_E1B19K-01        Q-------------------------------------------------
D4N3H6_E1B19K-01        Q-------------------------------------------------
M0QVK6_E1B19K-01        Q-------------------------------------------------
M0QVT4_E1B19K-01        Q-------------------------------------------------
E1AI10_E1B19K-01        Q-------------------------------------------------
H0PPE7_E1B19K-01        Q-------------------------------------------------
A0A3G8WIY5_E1B19K-      Q-------------------------------------------------
Q9YL99_E1B19K-01        Q-------------------------------------------------
A0A384ZUF2_E1B19K-      Q-------------------------------------------------
A0A384ZUM9_E1B19K-      Q-------------------------------------------------
T1UHQ8_E1B19K-01        Q-------------------------------------------------
W8VNG2_E1B19K-01        Q-------------------------------------------------
F8UFP5_E1B19K-01        Q-------------------------------------------------
M0QV87_E1B19K-01        Q-------------------------------------------------
M0QU02_E1B19K-01        Q-------------------------------------------------
T1UKV6_E1B19K-01        Q-------------------------------------------------
M0QV47_E1B19K-01        Q-------------------------------------------------
M0QUW8_E1B19K-01        Q-------------------------------------------------
E1CIJ0_E1B19K-01        Q-------------------------------------------------
M0QVG6_E1B19K-01        Q-------------------------------------------------
X4YVU5_E1B19K-01        Q-------------------------------------------------
M0QUS9_E1B19K-01        Q-------------------------------------------------
G1FBW4_E1B19K-01        Q-------------------------------------------------
M0QVP5_E1B19K-01        Q-------------------------------------------------
T1UKQ0_E1B19K-01        Q-------------------------------------------------
W8CZB0_E1B19K-01        Q-------------------------------------------------
G1FC01_E1B19K-01        Q-------------------------------------------------
G3CK71_E1B19K-01        Q-------------------------------------------------
T1UGT5_E1B19K-01        Q-------------------------------------------------
T1UK99_E1B19K-01        Q-------------------------------------------------
M0QTS5_E1B19K-01        Q-------------------------------------------------
M0QV08_E1B19K-01        Q-------------------------------------------------
G9JUV5_E1B19K-01        Q-------------------------------------------------
T1UGX3_E1B19K-01        Q-------------------------------------------------
Q7T951_E1B19K-01        K-------------------------------------------------
T1UE63_E1B19K-01        K-------------------------------------------------
Q8B8U7_E1B19K-01        K-------------------------------------------------
Q5UW22_E1B19K-01        K-------------------------------------------------
W6EIX6_E1B19K-01        K-------------------------------------------------
Q3ZL02_E1B19K-01        K-------------------------------------------------
T1UFS4_E1B19K-01        K-------------------------------------------------
A0A7G5F9T0_E1B19K-      K-------------------------------------------------
C7SRS7_E1B19K-01        K-------------------------------------------------
D2DM83_E1B19K-01        K-------------------------------------------------
T2CI10_E1B19K-01        K-------------------------------------------------
A0A0K0PX99_E1B19K-      K-------------------------------------------------
A0A0K0PX35_E1B19K-      K-------------------------------------------------
A0A8B0L9Y2_E1B19K-      K-------------------------------------------------
J7ID56_E1B19K-01        K-------------------------------------------------
A0A6M6AA96_E1B19K-      K-------------------------------------------------
A0A220VZ73_E1B19K-      K-------------------------------------------------
A0A8B0LD36_E1B19K-      K-------------------------------------------------
A0A8B0LBX6_E1B19K-      K-------------------------------------------------
R4HLE1_E1B19K-01        K-------------------------------------------------
R4HMC6_E1B19K-01        K-------------------------------------------------
P03248_E1B19K-02        K-------------------------------------------------
Q2KS85_E1B19K-01        K-------------------------------------------------
Q3ZKW2_E1B19K-01        K-------------------------------------------------
K7NG43_E1B19K-01        K-------------------------------------------------
Q2KRU2_E1B19K-01        K-------------------------------------------------
A0A8B0LCV0_E1B19K-      K-------------------------------------------------
T1UIP3_E1B19K-01        K-------------------------------------------------
R4HLJ6_E1B19K-01        K-------------------------------------------------
R4HLA0_E1B19K-01        K-------------------------------------------------
Q2Y0J3_E1B19K-01        K-------------------------------------------------
A0A5J6CTQ0_E1B19K-      K-------------------------------------------------
Q5EY83_E1B19K-01        K-------------------------------------------------
I6LEP5_E1B19K-01        K-------------------------------------------------
T1UF50_E1B19K-01        K-------------------------------------------------
Q6QPF3_E1B19K-01        N-------------------------------------------------
Q6QPB7_E1B19K-01        N-------------------------------------------------
Q6QPI9_E1B19K-01        N-------------------------------------------------
P10406_E1B19K-01        N-------------------------------------------------
Q5GFC7_E1B19K-02        N-------------------------------------------------
A0A2R3WN62_E1B19K-      N-------------------------------------------------
A0A3G8W6L2_E1B19K-      N-------------------------------------------------
Q5GFC7_E1B19K-01        N-------------------------------------------------
G9G841_E1B19K-01        N-------------------------------------------------
Q8UY91_E1B19K-01        N-------------------------------------------------
A0A1L3INW0_E1B19K-      E-------------------------------------------------
P06501_E1B19K-01        E-------------------------------------------------
A0A0M4N3Z1_E1B19K-      E-------------------------------------------------
Q8B6X5_E1B19K-01        E-------------------------------------------------
H9AAD9_E1B19K-01        Q-------------------------------------------------
H9AAH3_E1B19K-01        Q-------------------------------------------------
H9AAA8_E1B19K-01        Q-------------------------------------------------
M9YVA3_E1B19K-01        Q-------------------------------------------------
F2WTJ7_E1B19K-01        Q-------------------------------------------------
F2WTM9_E1B19K-01        Q-------------------------------------------------
H9AA76_E1B19K-01        Q-------------------------------------------------
A0A1C8EG46_E1B19K-      Q-------------------------------------------------
H9AAN8_E1B19K-01        Q-------------------------------------------------
H9AAS0_E1B19K-01        Q-------------------------------------------------
H9AAV3_E1B19K-01        Q-------------------------------------------------
H9AAY5_E1B19K-01        Q-------------------------------------------------
F6KST6_E1B19K-01        E-------------------------------------------------
A0A7L4WGT1_E1B19K-      Q-------------------------------------------------
A0A3S9SP19_E1B19K-      Q-------------------------------------------------
A0A291P1B2_E1B19K-      Q-------------------------------------------------
A0A5K6WAR5_E1B19K-      Q-------------------------------------------------
T1UG63_E1B19K-01        Q-------------------------------------------------
A0A6M5E4Y6_E1B19K-      Q-------------------------------------------------
P03247_E1B19K-01        Q-------------------------------------------------
A0A3G8W3H5_E1B19K-      Q-------------------------------------------------
A0A516UYI9_E1B19K-      Q-------------------------------------------------
A0A8F9W8V2_E1B19K-      Q-------------------------------------------------
A0A3S9SND6_E1B19K-      Q-------------------------------------------------
A0A3Q9HJZ5_E1B19K-      Q-------------------------------------------------
A0A513TZR1_E1B19K-      Q-------------------------------------------------
A0A516UYM9_E1B19K-      Q-------------------------------------------------
A0A7L4WG90_E1B19K-      Q-------------------------------------------------
A0A7L4WIG2_E1B19K-      Q-------------------------------------------------
J7I6T8_E1B19K-01        Q-------------------------------------------------
A0A7L4WK62_E1B19K-      Q-------------------------------------------------
A0A7D0TN91_E1B19K-      Q-------------------------------------------------
A0A3S9SNH4_E1B19K-      Q-------------------------------------------------
Q6WQ37_E1B19K-01        Q-------------------------------------------------
Q6VGV8_E1B19K-01        Q-------------------------------------------------
A0A3Q9HJ54_E1B19K-      Q-------------------------------------------------
A0A3S9SSS2_E1B19K-      Q-------------------------------------------------
A0A3S9SNY0_E1B19K-      Q-------------------------------------------------
A0A2H4PJ75_E1B19K-      Q-------------------------------------------------
A0A7D6TSN5_E1B19K-      Q-------------------------------------------------
Q71BY5_E1B19K-04        Q-------------------------------------------------
A0A4P2SGW2_E1B19K-      Q-------------------------------------------------
A0A7L4WIC2_E1B19K-      Q-------------------------------------------------
A0A7L4WJT1_E1B19K-      Q-------------------------------------------------
D3JIR7_E1B19K-01        Q-------------------------------------------------
A0A076V686_E1B19K-      Q-------------------------------------------------
A0A5H2QAX5_E1B19K-      Q-------------------------------------------------
G1DE13_E1B19K-01        Q-------------------------------------------------
D0Z5R9_E1B19K-01        Q-------------------------------------------------
T1UEX7_E1B19K-01        Q-------------------------------------------------
A0A3G8WH01_E1B19K-      Q-------------------------------------------------
P04492_E1B19K-01        Q-------------------------------------------------
A0A2H5AI99_E1B19K-      Q-------------------------------------------------
A0A0M3TH31_E1B19K-      Q-------------------------------------------------
M9YXY5_E1B19K-01        Q-------------------------------------------------
M9YVF6_E1B19K-01        Q-------------------------------------------------
A0MK43_E1B19K-01        Q-------------------------------------------------
A0A2H5AI21_E1B19K-      Q-------------------------------------------------
A0A0M5L3Y4_E1B19K-      Q-------------------------------------------------
Q5C8R2_E1B19K-01        Q-------------------------------------------------
A0A0A1EUB2_E1B19K-      Q-------------------------------------------------
A0A0A1EUC8_E1B19K-      Q-------------------------------------------------
A0A2H5AI04_E1B19K-      Q-------------------------------------------------
A0A2H5AI72_E1B19K-      Q-------------------------------------------------
A0A2H5AIL3_E1B19K-      Q-------------------------------------------------
A0A2H4CJZ0_E1B19K-      Q-------------------------------------------------
H8PFZ1_E1B19K-01        Q-------------------------------------------------
A0A7U3RVU4_E1B19K-      Q-------------------------------------------------
A0A142G3J2_E1B19K-      Q-------------------------------------------------
P10543_E1B19K-01        Q-------------------------------------------------
A0A6M6AEV2_E1B19K-      Q-------------------------------------------------
A0A7U3RWV6_E1B19K-      Q-------------------------------------------------
A0A1S6ELT2_E1B19K-      Q-------------------------------------------------
A0A3G4W995_E1B19K-      Q-------------------------------------------------
A0A898KBW7_E1B19K-      Q-------------------------------------------------
A0A482EVC6_E1B19K-      Q-------------------------------------------------
P10544_E1B19K-01        Q-------------------------------------------------
W0S1G8_E1B19K-01        Q-------------------------------------------------
A0A3G8W407_E1B19K-      Q-------------------------------------------------
A0A898KBS1_E1B19K-      Q-------------------------------------------------
F4ZCJ8_E1B19K-01        Q-------------------------------------------------
A0A6M6AES6_E1B19K-      Q-------------------------------------------------
A0A8G1GLF6_E1B19K-      Q-------------------------------------------------
Q71BY5_E1B19K-01        DEEGEEFVLDYVEQPGHGCRSCHYHRRNTGDPDIM---------------
Q71BY5_E1B19K-02        DEEG----------------------------------------------
P03248_E1B19K-03        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
D3JIR7_E1B19K-02        IGNGAIIEVDTSDRVAFRCRMQGMGPGVVGLGGITFINVRFAGDKFKGTL
A0A5H2QAX5_E1B19K-      IGNGAVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIM
T1UEX7_E1B19K-02        IGNGAVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIM
R4HLE1_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
R4HLA0_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
J7ID56_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
Q5EY83_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAITLMNIRFRGDGYNGIV
K7NG43_E1B19K-02        LGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFRGDGYNGIV
T1UIP3_E1B19K-02        SGNGAEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIV
Q2KRU2_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIV
Q2KS85_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIV
Q3ZKW2_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIV
R4HLJ6_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
R4HMC6_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
Q2Y0J3_E1B19K-02        SGNGAEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGDGYNGIV
I6LEP5_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
T1UF50_E1B19K-02        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
Q3ZL02_E1B19K-02        SGNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIV
T1UFS4_E1B19K-02        SGNGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIV
W6EIX6_E1B19K-02        SGNGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIV
T1UE63_E1B19K-02        SGNGAEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIV
A0A7D0TLU2_E1B19K-      SGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTV
A0A4P2SGW2_E1B19K-      SGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTV
Q6VGV8_E1B19K-02        SGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTV
M0QU02_E1B19K-02        SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
J7I6T8_E1B19K-02        SGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTV
T1UG63_E1B19K-02        SGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTV
A0A1P8C849_E1B19K-      SGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVL
T1UGY3_E1B19K-02        SGNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVL
M0QUW8_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
M0QVP5_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
M0QUS9_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
T1UKQ0_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
M0QV47_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
G1FBW4_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
F1DT57_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
E9P585_E1B19K-02        SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UKP8_E1B19K-02        SGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
W8CZB0_E1B19K-02        SGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1ULJ8_E1B19K-02        SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QUB4_E1B19K-02        SGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QVT4_E1B19K-02        SGNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QVG6_E1B19K-02        SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UK99_E1B19K-02        SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QV87_E1B19K-02        SGNGAEVVVDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UKV6_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVL
F8UFP5_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UGT5_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
C5HDR2_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A3S6PYX7_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A097I4T0_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A384ZUM9_E1B19K-      SGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QUJ3_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVM
T1UHQ8_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UHH6_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UHL7_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A075TSZ1_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QVK6_E1B19K-02        SGNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QUN2_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
E1AI10_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A384ZUF2_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
C4P207_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QTS5_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QV08_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QU76_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QU41_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
M0QVC7_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A3Q9FFS0_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UGX3_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
T1UHZ2_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVL
A0A0G2UY10_E1B19K-      SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVM
M0QUF3_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVM
G1FC01_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVM
G3CK71_E1B19K-02        SGNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVM
Q5GFC7_E1B19K-03        SGNGAEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTV
I6LEP5_E1B19K-03        SGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIV
T2CI10_E1B19K-02        SGNGAEVVIDTQDRTVFRCCMMGMWPGVVGMEAVTLMNVKFRGDGYNGVV
P04492_E1B19K-02        IGNGAEVEVDTSDRVAFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIM
A0MK43_E1B19K-02        IGHGALVQVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSV
A0A482EVC6_E1B19K-      IGNGAVVRFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKV
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-01        ---CSLCYMRTCGMFVYSPVSEPEPEPEPEPE----------PARPARRP
Q71BY5_E1B19K-02        ------------------PVSEPEPEPEPEPE----------PARPARRP
P03248_E1B19K-03        FMANTKLILHGCRFFGFNNTCEEA--------------------------
D3JIR7_E1B19K-02        FEANTSLVLHGVYFLNFSNTCVESWIKVSARGCTFYGCRRGLVGRPKSKM
A0A5H2QAX5_E1B19K-      FEANTSVVLHGVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKM
T1UEX7_E1B19K-02        FEANTSVVLHGVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKM
R4HLE1_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
R4HLA0_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
J7ID56_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
Q5EY83_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
K7NG43_E1B19K-02        FMANTKLILHGCSFFGVNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
T1UIP3_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
Q2KRU2_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
Q2KS85_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQL
Q3ZKW2_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQL
R4HLJ6_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
R4HMC6_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
Q2Y0J3_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
I6LEP5_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
T1UF50_E1B19K-02        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
Q3ZL02_E1B19K-02        FMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQL
T1UFS4_E1B19K-02        FMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQL
W6EIX6_E1B19K-02        FMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFCACWIATAGRTKSQL
T1UE63_E1B19K-02        FMANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQL
A0A7D0TLU2_E1B19K-      FLANTNLILHGPGFHRFVNTCIEAWTDVRVRGCAFYCCWKGVVCRPKSRA
A0A4P2SGW2_E1B19K-      FLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRA
Q6VGV8_E1B19K-02        FLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRA
M0QU02_E1B19K-02        FMANSHMTLHGCKFFGFNNMCAEVWGSAKIRGCVYYGCWMGVVGRPKSEM
J7I6T8_E1B19K-02        FLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRA
T1UG63_E1B19K-02        FLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRA
A0A1P8C849_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UGY3_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QUW8_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QVP5_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEM
M0QUS9_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
T1UKQ0_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QV47_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
G1FBW4_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEM
F1DT57_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
E9P585_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UKP8_E1B19K-02        FMANSHMTVHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
W8CZB0_E1B19K-02        FMTNSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1ULJ8_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QUB4_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QVT4_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QVG6_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UK99_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QV87_E1B19K-02        FMANSHMTVHGCSFFGFNNMCAEIWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UKV6_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
F8UFP5_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UGT5_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
C5HDR2_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEM
A0A3S6PYX7_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEM
A0A097I4T0_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEM
A0A384ZUM9_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QUJ3_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
T1UHQ8_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
T1UHH6_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
T1UHL7_E1B19K-02        FMANSHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
A0A075TSZ1_E1B19K-      FMANSHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QVK6_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QUN2_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
E1AI10_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
A0A384ZUF2_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
C4P207_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QTS5_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QV08_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QU76_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QU41_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
M0QVC7_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
A0A3Q9FFS0_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
T1UGX3_E1B19K-02        FMANSHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
T1UHZ2_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEM
A0A0G2UY10_E1B19K-      FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
M0QUF3_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
G1FC01_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
G3CK71_E1B19K-02        FMANSHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEM
Q5GFC7_E1B19K-03        FMANTKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSML
I6LEP5_E1B19K-03        FMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQL
T2CI10_E1B19K-02        FMANTKLILHGCSFFGFNNICVEAWGQVSVRGCSFYACWIATSGRTKSQL
P04492_E1B19K-02        FEANTCLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKL
A0MK43_E1B19K-02        FVTSTQLTLHGVYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIKSVM
A0A482EVC6_E1B19K-      FASTTQLTLHGVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQM
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        --SPAAGGSRRESESRPGPS------------------------------
A0A0M4NHE0_E1B19K-      --EKIV---KALDFSSPGRA------------------------------
H9AAK5_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
G0ZAH2_E1B19K-01        --G-VL---RELDFENTGRV------------------------------
A0A3Q9HK78_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SPV1_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A1W5PVU4_E1B19K-      --EKVI---CGLDFCTPGRT------------------------------
A0A0M3TH18_E1B19K-      --EKVI---CGLDFCTPGRT------------------------------
A0A097IW62_E1B19K-      --EKII---CSLDFCTPGRT------------------------------
A0A0A1EUE4_E1B19K-      --EKIV---KSLTFSSPGRT------------------------------
A0A2H5AI40_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AID8_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AII9_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIL0_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIN5_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIS9_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIT6_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIU0_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A2H5AIC5_E1B19K-      --EKII---RNLTFSSPGRT------------------------------
A0A0G2UY10_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
X4Y9D2_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
C5HDR2_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QVC7_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A3S6PYX7_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
Q4KSL0_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A1P8C849_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
T1UGY3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
H5T740_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A1J0MS84_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
A0A097I4T0_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
E5RWD9_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QU76_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A7R6T9I9_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
D3GBW3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUF3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QU41_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
F1DT57_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
B2VQE3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UHZ2_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A3Q9FFS0_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
T1ULJ8_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
E9P585_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UHL7_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A075TSZ1_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
T1UHH6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UKP8_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A291B0H2_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
B9A5Q1_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUB4_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUJ3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUN2_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
C4P207_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
E1CIM6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
D4N3H6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QVK6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QVT4_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
E1AI10_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
H0PPE7_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A3G8WIY5_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
Q9YL99_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
A0A384ZUF2_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
A0A384ZUM9_E1B19K-      --ERVL---HSLDFSSPGRT------------------------------
T1UHQ8_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
W8VNG2_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
F8UFP5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QV87_E1B19K-01        --ERVL---HSLDFSTPGRT------------------------------
M0QU02_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UKV6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QV47_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUW8_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
E1CIJ0_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QVG6_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
X4YVU5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QUS9_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
G1FBW4_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QVP5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UKQ0_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
W8CZB0_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
G1FC01_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
G3CK71_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UGT5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UK99_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QTS5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
M0QV08_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
G9JUV5_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
T1UGX3_E1B19K-01        --ERVL---HSLDFSSPGRT------------------------------
Q7T951_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
T1UE63_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q8B8U7_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q5UW22_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
W6EIX6_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q3ZL02_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
T1UFS4_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
A0A7G5F9T0_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
C7SRS7_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
D2DM83_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
T2CI10_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
A0A0K0PX99_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
A0A0K0PX35_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
A0A8B0L9Y2_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
J7ID56_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
A0A6M6AA96_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
A0A220VZ73_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
A0A8B0LD36_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
A0A8B0LBX6_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
R4HLE1_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
R4HMC6_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
P03248_E1B19K-02        --EKVL---SVLDFSTPGRT------------------------------
Q2KS85_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q3ZKW2_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
K7NG43_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q2KRU2_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
A0A8B0LCV0_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
T1UIP3_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
R4HLJ6_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
R4HLA0_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q2Y0J3_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
A0A5J6CTQ0_E1B19K-      --EKVL---SVLDFSTPGRT------------------------------
Q5EY83_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
I6LEP5_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
T1UF50_E1B19K-01        --EKVL---SVLDFSTPGRT------------------------------
Q6QPF3_E1B19K-01        --QSIL---RALDFSTPGRT------------------------------
Q6QPB7_E1B19K-01        --QSIL---RALDFSTPGRT------------------------------
Q6QPI9_E1B19K-01        --QSIL---RALDFSTPGRT------------------------------
P10406_E1B19K-01        --QRIS---RALDFTTPGRT------------------------------
Q5GFC7_E1B19K-02        --QRIS---RALDFTTPGRT------------------------------
A0A2R3WN62_E1B19K-      --QRIS---RALDFTTPGRT------------------------------
A0A3G8W6L2_E1B19K-      --QRIS---RALDFTTPGRT------------------------------
Q5GFC7_E1B19K-01        --QRIS---RALDFTTPGRT------------------------------
G9G841_E1B19K-01        --QRIV---RALDFTTPGRS------------------------------
Q8UY91_E1B19K-01        --QRIS---RALDFTTPGRT------------------------------
A0A1L3INW0_E1B19K-      --DKLL---VQLDFSTPGRA------------------------------
P06501_E1B19K-01        --EKIV---KELDFSSPGRA------------------------------
A0A0M4N3Z1_E1B19K-      --DKIV---KELDFSSPGRA------------------------------
Q8B6X5_E1B19K-01        --DKIV---KELDFSSPGRA------------------------------
H9AAD9_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AAH3_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AAA8_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
M9YVA3_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
F2WTJ7_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
F2WTM9_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AA76_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
A0A1C8EG46_E1B19K-      --EKIV---KALDFSSPGRA------------------------------
H9AAN8_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AAS0_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AAV3_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
H9AAY5_E1B19K-01        --EKIV---KALDFSSPGRA------------------------------
F6KST6_E1B19K-01        --ERLF---PQLDFSSPGRL------------------------------
A0A7L4WGT1_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SP19_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A291P1B2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A5K6WAR5_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
T1UG63_E1B19K-01        --EKVI---KTLDFSTPGRT------------------------------
A0A6M5E4Y6_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
P03247_E1B19K-01        --EKVI---KTLDFSTPGRA------------------------------
A0A3G8W3H5_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A516UYI9_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A8F9W8V2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SND6_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3Q9HJZ5_E1B19K-      --EKVI---KTLDFSTPGRV------------------------------
A0A513TZR1_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A516UYM9_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7L4WG90_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7L4WIG2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
J7I6T8_E1B19K-01        --EKVI---KTLDFSTPGRA------------------------------
A0A7L4WK62_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7D0TN91_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SNH4_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
Q6WQ37_E1B19K-01        --EKVI---KTLDFSTPGRA------------------------------
Q6VGV8_E1B19K-01        --EKVI---KTLDFSTPGRA------------------------------
A0A3Q9HJ54_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SSS2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A3S9SNY0_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A2H4PJ75_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7D6TSN5_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
Q71BY5_E1B19K-04        --EKVI---KTLDFSTPGRA------------------------------
A0A4P2SGW2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7L4WIC2_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
A0A7L4WJT1_E1B19K-      --EKVI---KTLDFSTPGRA------------------------------
D3JIR7_E1B19K-01        --EKVV---KSLDFSSAGRT------------------------------
A0A076V686_E1B19K-      --EKVV---RSLDFSSAGRT------------------------------
A0A5H2QAX5_E1B19K-      --ERVV---RSLDFSSSGRT------------------------------
G1DE13_E1B19K-01        --ERVV---RSLDFSSSGRT------------------------------
D0Z5R9_E1B19K-01        --ERVV---RSLDFSSSGRT------------------------------
T1UEX7_E1B19K-01        --ERVV---RSLDFSSSGRT------------------------------
A0A3G8WH01_E1B19K-      --EKVV---RSLDFSSVGRT------------------------------
P04492_E1B19K-01        --EKVV---RSLDFSSVGRT------------------------------
A0A2H5AI99_E1B19K-      --EKVI---KSLTFSSPGRV------------------------------
A0A0M3TH31_E1B19K-      --EKIV---KGLVFESTGRT------------------------------
M9YXY5_E1B19K-01        --EKIV---KGLVFESTGRT------------------------------
M9YVF6_E1B19K-01        --EKIV---KGLVFESTGRT------------------------------
A0MK43_E1B19K-01        --EKII---KNLTFTSPGRT------------------------------
A0A2H5AI21_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A0M5L3Y4_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
Q5C8R2_E1B19K-01        --EKII---KNLTFTSPGRT------------------------------
A0A0A1EUB2_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A0A1EUC8_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A2H5AI04_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A2H5AI72_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A2H5AIL3_E1B19K-      --EKII---KNLTFTSPGRT------------------------------
A0A2H4CJZ0_E1B19K-      --EAVV---RYLDFSTPGRT------------------------------
H8PFZ1_E1B19K-01        --EAVV---RYLDFSTPGRA------------------------------
A0A7U3RVU4_E1B19K-      --EIVI---RNLDFSSPGRT------------------------------
A0A142G3J2_E1B19K-      --EIVI---RNLDFSSPGRT------------------------------
P10543_E1B19K-01        --EIVI---RNLDFSSPGRT------------------------------
A0A6M6AEV2_E1B19K-      --EIVI---RNLDFSSPGRT------------------------------
A0A7U3RWV6_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
A0A1S6ELT2_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
A0A3G4W995_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
A0A898KBW7_E1B19K-      --EIVI---KNLDFSSPGRA------------------------------
A0A482EVC6_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
P10544_E1B19K-01        --EIVI---KNLDFSSPGRT------------------------------
W0S1G8_E1B19K-01        --EIVI---KNLDFSSPGRT------------------------------
A0A3G8W407_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
A0A898KBS1_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
F4ZCJ8_E1B19K-01        --EIVI---KNLDFSSPGRT------------------------------
A0A6M6AES6_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
A0A8G1GLF6_E1B19K-      --EIVI---KNLDFSSPGRT------------------------------
Q71BY5_E1B19K-01        KMVPAILRRPTSPVSRECNSSTD---------------------------
Q71BY5_E1B19K-02        KMVPAILRRPTSPVSRECNSSTD---------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        SVKKCLFEKCVLALIVEGDAHIRHNAASENTCFVLVKGMAVLRHNMVCGV
A0A5H2QAX5_E1B19K-      SVKKCLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGV
T1UEX7_E1B19K-02        SVKKCLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGV
R4HLE1_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
R4HLA0_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGH
J7ID56_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGH
Q5EY83_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETACFILIKGNASVKHNMICGH
K7NG43_E1B19K-02        SAKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
T1UIP3_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
Q2KRU2_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
Q2KS85_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
Q3ZKW2_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
R4HLJ6_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
R4HMC6_E1B19K-02        SVKKCMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGH
Q2Y0J3_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
I6LEP5_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
T1UF50_E1B19K-02        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
Q3ZL02_E1B19K-02        SLKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGA
T1UFS4_E1B19K-02        SLKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGA
W6EIX6_E1B19K-02        SLKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGA
T1UE63_E1B19K-02        SLKKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGA
A0A7D0TLU2_E1B19K-      SIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
A0A4P2SGW2_E1B19K-      SIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
Q6VGV8_E1B19K-02        SIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
M0QU02_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSIETGCFCLVKGTASLKHNVIKGC
J7I6T8_E1B19K-02        SIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
T1UG63_E1B19K-02        SIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGN
A0A1P8C849_E1B19K-      SVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
T1UGY3_E1B19K-02        SVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
M0QUW8_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
M0QVP5_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
M0QUS9_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
T1UKQ0_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
M0QV47_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
G1FBW4_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGC
F1DT57_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
E9P585_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
T1UKP8_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
W8CZB0_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
T1ULJ8_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
M0QUB4_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
M0QVT4_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
M0QVG6_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
T1UK99_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
M0QV87_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGC
T1UKV6_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
F8UFP5_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASIKHNMVKGC
T1UGT5_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGC
C5HDR2_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGC
A0A3S6PYX7_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGC
A0A097I4T0_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGC
A0A384ZUM9_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNVVKGC
M0QUJ3_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
T1UHQ8_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
T1UHH6_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASLKHNVVKGC
T1UHL7_E1B19K-02        SVKQCVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
A0A075TSZ1_E1B19K-      SVKQCVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QVK6_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QUN2_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
E1AI10_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
A0A384ZUF2_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
C4P207_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QTS5_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QV08_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QU76_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
M0QU41_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
M0QVC7_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
A0A3Q9FFS0_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
T1UGX3_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
T1UHZ2_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGC
A0A0G2UY10_E1B19K-      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
M0QUF3_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
G1FC01_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
G3CK71_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
Q5GFC7_E1B19K-03        SVKKCLFERCHLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGA
I6LEP5_E1B19K-03        SVKKCMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGH
T2CI10_E1B19K-02        SVKKCMFERCNLGILNEGEARVSHCASSETGCFILIKGNANVKHNMICGP
P04492_E1B19K-02        SVKKCLFEKCVLAILNEGDAHIRHNAASENACFVLLKGMAILKHNMVCGV
A0MK43_E1B19K-02        SVKKCIFERCVIALAVEGYGRIRNNAASENGCFLLLKGTASVKHNMICG-
A0A482EVC6_E1B19K-      SVKKCVFERCILAMVVEGQARIRHNAGSENVCFLLLKGTASVKHNMICG-
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        ------------------GGGVADLFPELHRVL-TRVSLTGVFDMNV---
A0A0M4NHE0_E1B19K-      ------------------VAAIAFAAFLLDRWN-AQTQLSPGYTLDY---
H9AAK5_E1B19K-01        ------------------VAAIAFAAFLLDRWN-AQTQLSPGYTLDY---
G0ZAH2_E1B19K-01        ------------------VAGLAFLAYLLDRWD-ENSVLSPGYRLDC---
A0A3Q9HK78_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SPV1_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A1W5PVU4_E1B19K-      ------------------IAALAFCAFILDKWN-KETHLSRGYTLDY---
A0A0M3TH18_E1B19K-      ------------------IAALAFCAFILDKWN-KETHLSKGYTLDY---
A0A097IW62_E1B19K-      ------------------IAALAFCTYILDRWN-KETHLSAGYTLDY---
A0A0A1EUE4_E1B19K-      ------------------VVSAAFITYILDQWSSSGSHLSWDYMLDY---
A0A2H5AI40_E1B19K-      ------------------VASAAFVAYILDQWSNSNSHLSWEYMLDY---
A0A2H5AID8_E1B19K-      ------------------VASAAFVAYILDQWSNSDSHLSWEYMLDY---
A0A2H5AII9_E1B19K-      ------------------VASAAFVAYILDQWSNSNSHLSWEYMLDY---
A0A2H5AIL0_E1B19K-      ------------------VASAAFVAYILDQWSNSDSHLSWEYMLDY---
A0A2H5AIN5_E1B19K-      ------------------VASAAFVAYILDQWSNSNSHLSWEYMLDY---
A0A2H5AIS9_E1B19K-      ------------------VASAAFVAYILDQWSNSDSHLSWEYMLDY---
A0A2H5AIT6_E1B19K-      ------------------VASAAFVAYILDQWSNSDSHLSWEYMLDY---
A0A2H5AIU0_E1B19K-      ------------------VASAAFVAYILDQWSNSNSHLSWEYMLDY---
A0A2H5AIC5_E1B19K-      ------------------VASAAFITYILDQWSNSDSHLSWEYMLDY---
A0A0G2UY10_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
X4Y9D2_E1B19K-01        ------------------TAGVAFVVFLVDKWR-QDTQLSRGYILDF---
C5HDR2_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
M0QVC7_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
A0A3S6PYX7_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
Q4KSL0_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A1P8C849_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UGY3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
H5T740_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
A0A1J0MS84_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
A0A097I4T0_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
E5RWD9_E1B19K-01        ------------------TAGVACVVFLVDKWS-QNTQLSRGYILDF---
M0QU76_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
A0A7R6T9I9_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
D3GBW3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
M0QUF3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
M0QU41_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
F1DT57_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
B2VQE3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
T1UHZ2_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
A0A3Q9FFS0_E1B19K-      ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
T1ULJ8_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
E9P585_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UHL7_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A075TSZ1_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UHH6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UKP8_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A291B0H2_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
B9A5Q1_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QUB4_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QUJ3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QUN2_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
C4P207_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
E1CIM6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
D4N3H6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QVK6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QVT4_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
E1AI10_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
H0PPE7_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A3G8WIY5_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
Q9YL99_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A384ZUF2_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
A0A384ZUM9_E1B19K-      ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UHQ8_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
W8VNG2_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
F8UFP5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
M0QV87_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QU02_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
T1UKV6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
M0QV47_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
M0QUW8_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
E1CIJ0_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
M0QVG6_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
X4YVU5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
M0QUS9_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QDTQLSRGYILDF---
G1FBW4_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
M0QVP5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
T1UKQ0_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
W8CZB0_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
G1FC01_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
G3CK71_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
T1UGT5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
T1UK99_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QQTHLTRDYILDF---
M0QTS5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
M0QV08_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
G9JUV5_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
T1UGX3_E1B19K-01        ------------------TAGVAFVVFLVDKWS-QNTQLSRGYILDF---
Q7T951_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
T1UE63_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
Q8B8U7_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
Q5UW22_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
W6EIX6_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
Q3ZL02_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
T1UFS4_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
A0A7G5F9T0_E1B19K-      ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
C7SRS7_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
D2DM83_E1B19K-01        ------------------AAAVAFLTFILDKWI-PQTHFSRGYVLDF---
T2CI10_E1B19K-01        ------------------AAAVAFLTFIFDKWI-PQTHFSKGYVLDF---
A0A0K0PX99_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSRGYVLDF---
A0A0K0PX35_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A8B0L9Y2_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
J7ID56_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A6M6AA96_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A220VZ73_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A8B0LD36_E1B19K-      ------------------AAAVAFLIFILDKWI-RQTHFSKGYVLDF---
A0A8B0LBX6_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
R4HLE1_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
R4HMC6_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
P03248_E1B19K-02        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q2KS85_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q3ZKW2_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
K7NG43_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q2KRU2_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A8B0LCV0_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
T1UIP3_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
R4HLJ6_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
R4HLA0_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q2Y0J3_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
A0A5J6CTQ0_E1B19K-      ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q5EY83_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
I6LEP5_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
T1UF50_E1B19K-01        ------------------AAAVAFLTFILDKWI-RQTHFSKGYVLDF---
Q6QPF3_E1B19K-01        ------------------TAAVAFFAFILDKWS-QETHFSRDYRLDC---
Q6QPB7_E1B19K-01        ------------------TAAVAFFAFILDKWS-QETHFSRDYRLDC---
Q6QPI9_E1B19K-01        ------------------TAAVAFFAFILDKWS-QETHFSRDYRLDC---
P10406_E1B19K-01        ------------------TAAVAFFAFIFDKWS-QETHFSRDYQLDF---
Q5GFC7_E1B19K-02        ------------------TAAVAFFAFIFDKWS-QETHFSRDYQLDF---
A0A2R3WN62_E1B19K-      ------------------TAAVAFFAFIFDKWS-QETHFSRDYQLDF---
A0A3G8W6L2_E1B19K-      ------------------TAAVAFFAFVLDKWS-QETHFSRDYQLDF---
Q5GFC7_E1B19K-01        ------------------TAAVAFFAFIFDKWS-QETHFSRDYQLDF---
G9G841_E1B19K-01        ------------------TAAVAFFAFLLDKWS-QETHFSRDYQLDF---
Q8UY91_E1B19K-01        ------------------TAAVAFFAFILDKWS-QETHFSRDYQLDF---
A0A1L3INW0_E1B19K-      ------------------CSGLAFVVHLLDRWN-QETYLSPGYTLDF---
P06501_E1B19K-01        ------------------VAAVAFASYLLDRWN-TRTHLSPGYQMDY---
A0A0M4N3Z1_E1B19K-      ------------------VAAVAFASYLLDRWN-TRTHLSPGYQMDY---
Q8B6X5_E1B19K-01        ------------------VAAVAFASYLLDRWN-TRTHLSPGYQMDY---
H9AAD9_E1B19K-01        ------------------VAAIAFAAFLLDRWN-AQTQLSPGYTLDY---
H9AAH3_E1B19K-01        ------------------VAAIAFAAFLLDRWN-AQTQLSPGYTLDY---
H9AAA8_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
M9YVA3_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
F2WTJ7_E1B19K-01        ------------------VAAIAFAAFILDRWN-SQTQLSPGYTLDY---
F2WTM9_E1B19K-01        ------------------VAAIAFAAFILDRWN-SQTQLSPGYTLDY---
H9AA76_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
A0A1C8EG46_E1B19K-      ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
H9AAN8_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
H9AAS0_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
H9AAV3_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
H9AAY5_E1B19K-01        ------------------VAAIAFAAFILDRWN-TQTQLSPGYTLDY---
F6KST6_E1B19K-01        ------------------CSALAFVVHLLDRWN-EQTQLSPGYTLDF---
A0A7L4WGT1_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SP19_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A291P1B2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A5K6WAR5_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
T1UG63_E1B19K-01        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A6M5E4Y6_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
P03247_E1B19K-01        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3G8W3H5_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A516UYI9_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A8F9W8V2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SND6_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3Q9HJZ5_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A513TZR1_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A516UYM9_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7L4WG90_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7L4WIG2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
J7I6T8_E1B19K-01        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7L4WK62_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7D0TN91_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SNH4_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
Q6WQ37_E1B19K-01        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
Q6VGV8_E1B19K-01        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3Q9HJ54_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SSS2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A3S9SNY0_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A2H4PJ75_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7D6TSN5_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
Q71BY5_E1B19K-04        ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A4P2SGW2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7L4WIC2_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
A0A7L4WJT1_E1B19K-      ------------------AAAVAFLSFIKDKWS-EETHLSGGYLLDF---
D3JIR7_E1B19K-01        ------------------VASIAFLVTVLDKWS-QTSQLSWDYMLDY---
A0A076V686_E1B19K-      ------------------VASIAFLVTVLDKWS-QASQLSWDYMLDY---
A0A5H2QAX5_E1B19K-      ------------------VASIAFLATVLDKWS-ERSHLSWDYMLDY---
G1DE13_E1B19K-01        ------------------VASIAFLVTVLDKWS-ERSHLSWDYMLDY---
D0Z5R9_E1B19K-01        ------------------VASIAFLATVLDKWS-ERSHLSWDYMLDY---
T1UEX7_E1B19K-01        ------------------VASIAFLATVLDKWS-ERSHLSWDYMLDY---
A0A3G8WH01_E1B19K-      ------------------VASIAFLATILDKWS-EKSHLSWDYMLDY---
P04492_E1B19K-01        ------------------VASIAFLATILDKWS-EKSHLSWDYMLDY---
A0A2H5AI99_E1B19K-      ------------------VTSLAFICHLLDKWS-SDSHLSWNYMLDY---
A0A0M3TH31_E1B19K-      ------------------VVSVAFICFLLDKWS-SDSHLSWDYMLDY---
M9YXY5_E1B19K-01        ------------------VVSVAFICFLLDKWS-SDSHLSWDYMLDY---
M9YVF6_E1B19K-01        ------------------VVSVAFICFLLDKWS-SDSHLSWDYMLDY---
A0MK43_E1B19K-01        ------------------VASAAFITYILDQWSNSDSHLSWEYMLDY---
A0A2H5AI21_E1B19K-      ------------------VASAAFITYILDQWSNSDSHLSWEYMLDY---
A0A0M5L3Y4_E1B19K-      ------------------VASAAFITYILDQWSNSDSHLSWEYMLDY---
Q5C8R2_E1B19K-01        ------------------VASAAFITYILDQWSNSDSHLSWEYMLDY---
A0A0A1EUB2_E1B19K-      ------------------VASAAFITYILDQWSNSGSHLSWEYMLDY---
A0A0A1EUC8_E1B19K-      ------------------VASAAFITYILDQWSNSGSHLSWEYMLDY---
A0A2H5AI04_E1B19K-      ------------------VASAAFITYILDQWSNSGSHLSWEYMLDY---
A0A2H5AI72_E1B19K-      ------------------VASAAFITYILDQWSNSGSHLSWEYMLDY---
A0A2H5AIL3_E1B19K-      ------------------VASAAFITYILDQWSNSGSHLSWEYMLDY---
A0A2H4CJZ0_E1B19K-      ------------------VSALAFICFVLDRWS-AQTRLSPGYTLDY---
H8PFZ1_E1B19K-01        ------------------VSAIAFICFVLDRWS-AQTRLSPGYTLDY---
A0A7U3RVU4_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSQGYTLDY---
A0A142G3J2_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSQGYTLDY---
P10543_E1B19K-01        ------------------VSGLAFICFILDQWS-AQTHLSQGYTLDY---
A0A6M6AEV2_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSQGYTLDY---
A0A7U3RWV6_E1B19K-      ------------------VSGVGLIWCVCIQES-AYTHLSEGYTLDY---
A0A1S6ELT2_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A3G4W995_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A898KBW7_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A482EVC6_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
P10544_E1B19K-01        ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
W0S1G8_E1B19K-01        ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A3G8W407_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A898KBS1_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
F4ZCJ8_E1B19K-01        ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A6M6AES6_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
A0A8G1GLF6_E1B19K-      ------------------VSGLAFICFILDQWS-AQTHLSEGYTLDY---
Q71BY5_E1B19K-01        ---------SCDSGPSNTPPEIH---------PVVPLCPIKPVAVRVGGR
Q71BY5_E1B19K-02        ---------SCDSGPSNTPPEIH---------PVVPLCPIKPVAVRVGGR
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        SDQSARRYVTCADGNCHALKTIHVVSHVKHRWPVCDHNMFMRCSMHLGLR
A0A5H2QAX5_E1B19K-      SDQTMRRFVTCADGNCHTLKTVHIVSHARYCWPVCDHNMFMRCTIHLGLR
T1UEX7_E1B19K-02        SDQTMRRFVTCADGNCHTLKTVHIVSHARYCWPVCDHNMFMRCTIHLGLR
R4HLE1_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
R4HLA0_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
J7ID56_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q5EY83_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
K7NG43_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
T1UIP3_E1B19K-02        SNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q2KRU2_E1B19K-02        SNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q2KS85_E1B19K-02        SNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q3ZKW2_E1B19K-02        SNERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
R4HLJ6_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
R4HMC6_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q2Y0J3_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
I6LEP5_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
T1UF50_E1B19K-02        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
Q3ZL02_E1B19K-02        SDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGR
T1UFS4_E1B19K-02        SDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGR
W6EIX6_E1B19K-02        SDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGR
T1UE63_E1B19K-02        SDERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGR
A0A7D0TLU2_E1B19K-      CEALSSQLPTTMLCINHSLKIIHVASHSRKAWPVFEHNILTRCSLHLGNR
A0A4P2SGW2_E1B19K-      CEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
Q6VGV8_E1B19K-02        CEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
M0QU02_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHITSHARKKWPVFENNMLIKCHVHLGVR
J7I6T8_E1B19K-02        CEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
T1UG63_E1B19K-02        CEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNR
A0A1P8C849_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
T1UGY3_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QUW8_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
M0QVP5_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
M0QUS9_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
T1UKQ0_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
M0QV47_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
G1FBW4_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCHVHLGAR
F1DT57_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCHMHLGAR
E9P585_E1B19K-02        TDERMYNMLTCDSGVCYILKNIHVTAHPRKKWPVFENNLLIKCHMHLGAR
T1UKP8_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
W8CZB0_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
T1ULJ8_E1B19K-02        TDERMYNMLTCDSGVCYILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
M0QUB4_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
M0QVT4_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
M0QVG6_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCHMHLGAR
T1UK99_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCHMHLGAR
M0QV87_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHSRKKWPVFENNLLIKCHMHLGAR
T1UKV6_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
F8UFP5_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGVR
T1UGT5_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPLFENNLLIKCHVHLGAR
C5HDR2_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A3S6PYX7_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A097I4T0_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A384ZUM9_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCHMHLGAR
M0QUJ3_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
T1UHQ8_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCHMHLGAR
T1UHH6_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
T1UHL7_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A075TSZ1_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QVK6_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QUN2_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
E1AI10_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A384ZUF2_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
C4P207_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QTS5_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGAR
M0QV08_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGAR
M0QU76_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QU41_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QVC7_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A3Q9FFS0_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
T1UGX3_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHVHLGAR
T1UHZ2_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A0G2UY10_E1B19K-      TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
M0QUF3_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
G1FC01_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
G3CK71_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
Q5GFC7_E1B19K-03        SDERGYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEHNVMTRCNMHLGAR
I6LEP5_E1B19K-03        SDERPYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGR
T2CI10_E1B19K-02        SDERPYQMLTCAGGHCNMLATVHIVSHPRKKWPVLEHNVMTKCTMHVGGR
P04492_E1B19K-02        SDQTMRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLR
A0MK43_E1B19K-02        SGLCPSQLLTCADGNCHTLRTVHIVSHSRRTWPTFEHNMLMRCAVHLGAR
A0A482EVC6_E1B19K-      TG--HSQLLTCADGNCQTLKVIHVVSHQRRPWPVFEHNMLMRCTMHLGAR
Q71BY5_E1B19K-03        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-04        ---------------------------------EVWKILRYDEY------
A0A0M4NHE0_E1B19K-      ---------------------------------ISLQLWRFWLR------
H9AAK5_E1B19K-01        ---------------------------------ISLQLWRFWLR------
G0ZAH2_E1B19K-01        ---------------------------------LALAIWKHTLREGILRG
A0A3Q9HK78_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SPV1_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A1W5PVU4_E1B19K-      ---------------------------------ISLQLWKAYMR------
A0A0M3TH18_E1B19K-      ---------------------------------ISLQLWKAYMR------
A0A097IW62_E1B19K-      ---------------------------------ITLQLWKAYMR------
A0A0A1EUE4_E1B19K-      ---------------------------------LAMALWRAMLR------
A0A2H5AI40_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AID8_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AII9_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIL0_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIN5_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIS9_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIT6_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIU0_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A2H5AIC5_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A0G2UY10_E1B19K-      ---------------------------------AAMHLWRSWIR------
X4Y9D2_E1B19K-01        ---------------------------------AAMHLWRSWIR------
C5HDR2_E1B19K-01        ---------------------------------AAMHLWRAWVR------
M0QVC7_E1B19K-01        ---------------------------------AAMHLWRAWVR------
A0A3S6PYX7_E1B19K-      ---------------------------------AAMHLWRAWVR------
Q4KSL0_E1B19K-01        ---------------------------------AAMHLWRAWIR------
A0A1P8C849_E1B19K-      ---------------------------------AAMHLWRAWMR------
T1UGY3_E1B19K-01        ---------------------------------AAMHLWRAWMR------
H5T740_E1B19K-01        ---------------------------------TAMHLWKAWVR------
A0A1J0MS84_E1B19K-      ---------------------------------AAMHLWRSWVR------
A0A097I4T0_E1B19K-      ---------------------------------AAMHLWRAWVR------
E5RWD9_E1B19K-01        ---------------------------------AAMHLWRAWVR------
M0QU76_E1B19K-01        ---------------------------------AAMHLWRAWVR------
A0A7R6T9I9_E1B19K-      ---------------------------------AAMHLWRAWVR------
D3GBW3_E1B19K-01        ---------------------------------AAMHLWRAWVR------
M0QUF3_E1B19K-01        ---------------------------------AAMHLWRAWVR------
M0QU41_E1B19K-01        ---------------------------------AAMHLWRAWVR------
F1DT57_E1B19K-01        ---------------------------------AAMHLWRAWVR------
B2VQE3_E1B19K-01        ---------------------------------AAMHLWRAWVR------
T1UHZ2_E1B19K-01        ---------------------------------AAMHLWRAWVR------
A0A3Q9FFS0_E1B19K-      ---------------------------------AAMHLWRAWVR------
T1ULJ8_E1B19K-01        ---------------------------------AAMHLWRAWIR------
E9P585_E1B19K-01        ---------------------------------AAMHLWRAWIR------
T1UHL7_E1B19K-01        ---------------------------------AAMHLWRSWIR------
A0A075TSZ1_E1B19K-      ---------------------------------AAMHLWRSWIR------
T1UHH6_E1B19K-01        ---------------------------------AAMHLWRSWIR------
T1UKP8_E1B19K-01        ---------------------------------AAMHLWRSWIR------
A0A291B0H2_E1B19K-      ---------------------------------AAMHLWRAWIR------
B9A5Q1_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QUB4_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QUJ3_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QUN2_E1B19K-01        ---------------------------------AAMHLWRAWIR------
C4P207_E1B19K-01        ---------------------------------AAMHLWRAWIR------
E1CIM6_E1B19K-01        ---------------------------------AAMHLWRAWIR------
D4N3H6_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QVK6_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QVT4_E1B19K-01        ---------------------------------AAMHLWRAWIR------
E1AI10_E1B19K-01        ---------------------------------AAMHLWRAWIR------
H0PPE7_E1B19K-01        ---------------------------------AAMHLWRAWIR------
A0A3G8WIY5_E1B19K-      ---------------------------------AAMHLWRAWIR------
Q9YL99_E1B19K-01        ---------------------------------AAMHLWRAWIR------
A0A384ZUF2_E1B19K-      ---------------------------------AAMHLWRAWIR------
A0A384ZUM9_E1B19K-      ---------------------------------AAMHLWRAWIR------
T1UHQ8_E1B19K-01        ---------------------------------AAMHLWRAWIR------
W8VNG2_E1B19K-01        ---------------------------------AAMHLWRAWIR------
F8UFP5_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QV87_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QU02_E1B19K-01        ---------------------------------AAMHLWRAWIR------
T1UKV6_E1B19K-01        ---------------------------------AAMHLWRAWIR------
M0QV47_E1B19K-01        ---------------------------------TAMHLWKAWVR------
M0QUW8_E1B19K-01        ---------------------------------TAMHLWKAWVR------
E1CIJ0_E1B19K-01        ---------------------------------TAMHLWKAWVR------
M0QVG6_E1B19K-01        ---------------------------------TAMHLWKAWVR------
X4YVU5_E1B19K-01        ---------------------------------TAMHLWKAWVR------
M0QUS9_E1B19K-01        ---------------------------------TAMHLWRAWVR------
G1FBW4_E1B19K-01        ---------------------------------TAMHLWKAWVR------
M0QVP5_E1B19K-01        ---------------------------------TAMHLWKAWVR------
T1UKQ0_E1B19K-01        ---------------------------------TAMHLWKAWVR------
W8CZB0_E1B19K-01        ---------------------------------AAMHLWRAWVR------
G1FC01_E1B19K-01        ---------------------------------AAMHLWRAWVR------
G3CK71_E1B19K-01        ---------------------------------AAMHLWRAWVR------
T1UGT5_E1B19K-01        ---------------------------------AAMHLWRAWVR------
T1UK99_E1B19K-01        ---------------------------------TAMHLWKAWVR------
M0QTS5_E1B19K-01        ---------------------------------AAMHLWRAWVR------
M0QV08_E1B19K-01        ---------------------------------AAMHLWRAWVR------
G9JUV5_E1B19K-01        ---------------------------------AAMHLWRAWVR------
T1UGX3_E1B19K-01        ---------------------------------AAMHLWRAWVR------
Q7T951_E1B19K-01        ---------------------------------IATALWRTWKV------
T1UE63_E1B19K-01        ---------------------------------IATALWRTWKV------
Q8B8U7_E1B19K-01        ---------------------------------IATALWRTWKV------
Q5UW22_E1B19K-01        ---------------------------------IATALWRTWKV------
W6EIX6_E1B19K-01        ---------------------------------IATALWRTWKV------
Q3ZL02_E1B19K-01        ---------------------------------VATALWRTWKV------
T1UFS4_E1B19K-01        ---------------------------------VATALWRTWKV------
A0A7G5F9T0_E1B19K-      ---------------------------------VATALWRTWKV------
C7SRS7_E1B19K-01        ---------------------------------VATALWRTWKV------
D2DM83_E1B19K-01        ---------------------------------VATALWRTWKV------
T2CI10_E1B19K-01        ---------------------------------IAAALWRTWKA------
A0A0K0PX99_E1B19K-      ---------------------------------IAAALWRTWKA------
A0A0K0PX35_E1B19K-      ---------------------------------IAAALWRTWKA------
A0A8B0L9Y2_E1B19K-      ---------------------------------IAAALWRTWKA------
J7ID56_E1B19K-01        ---------------------------------IAAALWRTWKA------
A0A6M6AA96_E1B19K-      ---------------------------------IAAALWRTWKA------
A0A220VZ73_E1B19K-      ---------------------------------IAAALWRTWKA------
A0A8B0LD36_E1B19K-      ---------------------------------IAAALWRTWKA------
A0A8B0LBX6_E1B19K-      ---------------------------------IAAALWRTWKA------
R4HLE1_E1B19K-01        ---------------------------------IAAALWRTWKA------
R4HMC6_E1B19K-01        ---------------------------------IAAALWRTWKA------
P03248_E1B19K-02        ---------------------------------IAAALWRTWKA------
Q2KS85_E1B19K-01        ---------------------------------IAAALWRTWKA------
Q3ZKW2_E1B19K-01        ---------------------------------IAAALWRTWKA------
K7NG43_E1B19K-01        ---------------------------------IAAALWRTWKA------
Q2KRU2_E1B19K-01        ---------------------------------IAAALWRTWKA------
A0A8B0LCV0_E1B19K-      ---------------------------------IAAALWRTWKA------
T1UIP3_E1B19K-01        ---------------------------------IAAALWRTWKA------
R4HLJ6_E1B19K-01        ---------------------------------IAAALWRTWKA------
R4HLA0_E1B19K-01        ---------------------------------IAAALWRTWKA------
Q2Y0J3_E1B19K-01        ---------------------------------IAAALWRTWKA------
A0A5J6CTQ0_E1B19K-      ---------------------------------IAAALWRTWKA------
Q5EY83_E1B19K-01        ---------------------------------IAAALWRTWKA------
I6LEP5_E1B19K-01        ---------------------------------IAAALWRTWKA------
T1UF50_E1B19K-01        ---------------------------------IAAALWRTWKA------
Q6QPF3_E1B19K-01        ---------------------------------LAVALWRTWRC------
Q6QPB7_E1B19K-01        ---------------------------------LAVALWRTWRC------
Q6QPI9_E1B19K-01        ---------------------------------LAVALWRTWRC------
P10406_E1B19K-01        ---------------------------------LAVALWRTWKC------
Q5GFC7_E1B19K-02        ---------------------------------LAVALWRTWKC------
A0A2R3WN62_E1B19K-      ---------------------------------LAVALWRTWKC------
A0A3G8W6L2_E1B19K-      ---------------------------------LAVALWRAWKC------
Q5GFC7_E1B19K-01        ---------------------------------LAVALWRTWKC------
G9G841_E1B19K-01        ---------------------------------LAVALWRTWKS------
Q8UY91_E1B19K-01        ---------------------------------LAVALWRTWKC------
A0A1L3INW0_E1B19K-      ---------------------------------LTLSLWKTGLK------
P06501_E1B19K-01        ---------------------------------ISLNLWKFWLR------
A0A0M4N3Z1_E1B19K-      ---------------------------------ISLNLWKFWLR------
Q8B6X5_E1B19K-01        ---------------------------------IRLNLWKFWLR------
H9AAD9_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AAH3_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AAA8_E1B19K-01        ---------------------------------ISLQLWRFWLR------
M9YVA3_E1B19K-01        ---------------------------------ISLQLWRFWLR------
F2WTJ7_E1B19K-01        ---------------------------------ISLQLWRFWLR------
F2WTM9_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AA76_E1B19K-01        ---------------------------------ISLQLWRFWLR------
A0A1C8EG46_E1B19K-      ---------------------------------ISLQLWRFWLR------
H9AAN8_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AAS0_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AAV3_E1B19K-01        ---------------------------------ISLQLWRFWLR------
H9AAY5_E1B19K-01        ---------------------------------ISLQLWRFWLR------
F6KST6_E1B19K-01        ---------------------------------LTLCLWKFGIR------
A0A7L4WGT1_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SP19_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A291P1B2_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A5K6WAR5_E1B19K-      ---------------------------------LAMHLWRAVVR------
T1UG63_E1B19K-01        ---------------------------------LAMHLWRAVVR------
A0A6M5E4Y6_E1B19K-      ---------------------------------LAMHLWRAVVR------
P03247_E1B19K-01        ---------------------------------LAMHLWRAVVR------
A0A3G8W3H5_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A516UYI9_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A8F9W8V2_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SND6_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3Q9HJZ5_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A513TZR1_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A516UYM9_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7L4WG90_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7L4WIG2_E1B19K-      ---------------------------------LAMHLWRAVVR------
J7I6T8_E1B19K-01        ---------------------------------LAMHLWRAVVR------
A0A7L4WK62_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7D0TN91_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SNH4_E1B19K-      ---------------------------------LAMHLWRAVVR------
Q6WQ37_E1B19K-01        ---------------------------------LAMHLWRAVVR------
Q6VGV8_E1B19K-01        ---------------------------------LAMHLWRAVVR------
A0A3Q9HJ54_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SSS2_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A3S9SNY0_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A2H4PJ75_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7D6TSN5_E1B19K-      ---------------------------------LAMHLWRAVVR------
Q71BY5_E1B19K-04        ---------------------------------LAMHLWRAVVR------
A0A4P2SGW2_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7L4WIC2_E1B19K-      ---------------------------------LAMHLWRAVVR------
A0A7L4WJT1_E1B19K-      ---------------------------------LAMHLWRAVVR------
D3JIR7_E1B19K-01        ---------------------------------MAMQLWRAWLT------
A0A076V686_E1B19K-      ---------------------------------MTMQLWRAWLT------
A0A5H2QAX5_E1B19K-      ---------------------------------MTMHLWRAWLK------
G1DE13_E1B19K-01        ---------------------------------MAMHLWRAWLK------
D0Z5R9_E1B19K-01        ---------------------------------MAMHLWRAWLK------
T1UEX7_E1B19K-01        ---------------------------------MAMHLWRAWLK------
A0A3G8WH01_E1B19K-      ---------------------------------MSMQLWRAWLK------
P04492_E1B19K-01        ---------------------------------MSMQLWRAWLK------
A0A2H5AI99_E1B19K-      ---------------------------------LSMAVWRAML-------
A0A0M3TH31_E1B19K-      ---------------------------------MTMALWRALLR------
M9YXY5_E1B19K-01        ---------------------------------MTMALWRALLR------
M9YVF6_E1B19K-01        ---------------------------------MTMALWRALLR------
A0MK43_E1B19K-01        ---------------------------------MAMALWRAMLR------
A0A2H5AI21_E1B19K-      ---------------------------------MAMALWRAMLR------
A0A0M5L3Y4_E1B19K-      ---------------------------------MAMALWRAMLR------
Q5C8R2_E1B19K-01        ---------------------------------MAMALWRAMLR------
A0A0A1EUB2_E1B19K-      ---------------------------------MSMALWRAMLR------
A0A0A1EUC8_E1B19K-      ---------------------------------MSMALWRAMLR------
A0A2H5AI04_E1B19K-      ---------------------------------MSMALWRAMLR------
A0A2H5AI72_E1B19K-      ---------------------------------MSMALWRAMLR------
A0A2H5AIL3_E1B19K-      ---------------------------------MSMALWRAMLR------
A0A2H4CJZ0_E1B19K-      ---------------------------------LTMSLWRAMLR------
H8PFZ1_E1B19K-01        ---------------------------------LTMSLWRAMLR------
A0A7U3RVU4_E1B19K-      ---------------------------------MAMALWRTLLR------
A0A142G3J2_E1B19K-      ---------------------------------MAMALWRTLLR------
P10543_E1B19K-01        ---------------------------------MAMALWRTLLR------
A0A6M6AEV2_E1B19K-      ---------------------------------MAMALWRTLLR------
A0A7U3RWV6_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A1S6ELT2_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A3G4W995_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A898KBW7_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A482EVC6_E1B19K-      ---------------------------------MTMALWRTLLR------
P10544_E1B19K-01        ---------------------------------MTMALWRTLLR------
W0S1G8_E1B19K-01        ---------------------------------MTMALWRTLLR------
A0A3G8W407_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A898KBS1_E1B19K-      ---------------------------------MTMALWRTLLR------
F4ZCJ8_E1B19K-01        ---------------------------------MTMALWRTLLR------
A0A6M6AES6_E1B19K-      ---------------------------------MTMALWRTLLR------
A0A8G1GLF6_E1B19K-      ---------------------------------MTMALWRTLLR------
Q71BY5_E1B19K-01        R-------------------------------------------------
Q71BY5_E1B19K-02        R-------------------------------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        RGMFVPFQCNLSHTNVLLEPEVFSRISLNGVFDLSVELYKVIRYDD-TRH
A0A5H2QAX5_E1B19K-      RGVFRPSQCNFSHSNVLLEPEAFSRVSLNGVFDLSVELCKIIRYDDAARH
T1UEX7_E1B19K-02        RGVFRPSQCNFSHSNVMLEPEAFSRVSLNGVFDLSVELCKIIRYDDAARH
R4HLE1_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKS
R4HLA0_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
J7ID56_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q5EY83_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSVTGIFDMNIQLWKILRY-DDTKP
K7NG43_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
T1UIP3_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q2KRU2_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q2KS85_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q3ZKW2_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
R4HLJ6_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
R4HMC6_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q2Y0J3_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
I6LEP5_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
T1UF50_E1B19K-02        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
Q3ZL02_E1B19K-02        RGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-DDTRS
T1UFS4_E1B19K-02        RGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-DDTRS
W6EIX6_E1B19K-02        RGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-DDTRS
T1UE63_E1B19K-02        RGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRY-DDTRS
A0A7D0TLU2_E1B19K-      RGVFLPYQCNLSHTKILLEPMVMSKVNLNGVFDMTMKIWKVLRY-DETRT
A0A4P2SGW2_E1B19K-      RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-DETRT
Q6VGV8_E1B19K-02        RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-DETRT
M0QU02_E1B19K-02        RGTFQPYQCNFSQTKLLLESDAFSRVNLNGIFDMDVSVYKILRY-DETRS
J7I6T8_E1B19K-02        RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-DETRT
T1UG63_E1B19K-02        RGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-DETRT
A0A1P8C849_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UGY3_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QUW8_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QVP5_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QUS9_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
T1UKQ0_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QV47_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
G1FBW4_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
F1DT57_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
E9P585_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
T1UKP8_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
W8CZB0_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
T1ULJ8_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QUB4_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QVT4_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QVG6_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
T1UK99_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QV87_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UKV6_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
F8UFP5_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UGT5_E1B19K-02        RGTFQPYQCNLSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
C5HDR2_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A3S6PYX7_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A097I4T0_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A384ZUM9_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QUJ3_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UHQ8_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UHH6_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UHL7_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A075TSZ1_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QVK6_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QUN2_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
E1AI10_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A384ZUF2_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
C4P207_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QTS5_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QV08_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QU76_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QU41_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETRS
M0QVC7_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A3Q9FFS0_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UGX3_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
T1UHZ2_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
A0A0G2UY10_E1B19K-      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
M0QUF3_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
G1FC01_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
G3CK71_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-DETKS
Q5GFC7_E1B19K-03        RGMFMPYQCNLNYVKVLLEPDVMSRVSLTGVFDMNVEVWKILRY-DEYKT
I6LEP5_E1B19K-03        RGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-DDTKP
T2CI10_E1B19K-02        RGMLMPYQCNMNNVKVMLEPDAFSRMSLTGIFDMNLQIWKILRY-DDTKS
P04492_E1B19K-02        RGMFRPSQCNFSHSNIMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRH
A0MK43_E1B19K-02        RGVFMPYQCNFSHTKILLETDSFPRVCFNGVFDMSMELFKVIRY-DETKS
A0A482EVC6_E1B19K-      RGMFSPYQSNFCHTKVLMETDAFSRVWWSGVFDLTIELYKVVRY-DELKA
Q71BY5_E1B19K-03        ------------MRHIICHGGVITEEMAASLLDQLIEEVLCLNL-SLSPS
Q5EY83_E1B19K-03        ----------------MLEPDAFSRVSVTGIFDMNIQLWKILRY-DDTKP
Q5GFC7_E1B19K-05        ----------------MESRNPFQQGLPAGFLSSSF----VENM-EVPAP
                                                                          

Q5GFC7_E1B19K-04        --KTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGEES
A0A0M4NHE0_E1B19K-      -----RRVYNYSRGLP-----PLGLASVAEERSEESKPEVNPEAQGEAKE
H9AAK5_E1B19K-01        -----RRVYNYSRGLP-----PLGLASVAEERSEESKPEVNPEAQGEAKE
G0ZAH2_E1B19K-01        VMQGPRARVNREIRRE-----VEERLTQVQRELEERERERQQREREQQQQ
A0A3Q9HK78_E1B19K-      --HKNRLLLLSSVRPA-----IIPTEE------QQQQQQQQEEARRRRRQ
A0A3S9SPV1_E1B19K-      --HKNRLLLLSSVRPA-----IIPTEEQQQQQQQQQQQQQQEEARRRRRQ
A0A1W5PVU4_E1B19K-      --KG--KIYTFSQGPRSLPQRVRR----------RLGFQTEDQTRLLEAE
A0A0M3TH18_E1B19K-      --KG--KIYTF-------SQGPRSLPQ---RVRRRLGFKTEDQTRLLEAE
A0A097IW62_E1B19K-      --KG--KIYTF-------SREPRSLQRLQTSLRRRLGMPTDDRVCLLEA-
A0A0A1EUE4_E1B19K-      --RR---VCIYSRAQP-------------------PRLDRVVEEDEPDET
A0A2H5AI40_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AID8_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AII9_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIL0_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIN5_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIS9_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIT6_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIU0_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A2H5AIC5_E1B19K-      --RR---VCIYLRAQP-------------------PRLDRVVEENEPEET
A0A0G2UY10_E1B19K-      --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
X4Y9D2_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
C5HDR2_E1B19K-01        --QRGQRILNYWLIQP-AVPGLLRL---------HRQTSMLEEEMRQAMD
M0QVC7_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A3S6PYX7_E1B19K-      --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
Q4KSL0_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A1P8C849_E1B19K-      --QRGQRILNYWLLQP-AALGLLHL---------HRQTSMLEEEMREAMD
T1UGY3_E1B19K-01        --QRGQRILNYWLLQP-AASGLLHL---------HRQTSMLEEEMREAMD
H5T740_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A1J0MS84_E1B19K-      --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A097I4T0_E1B19K-      --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
E5RWD9_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QU76_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A7R6T9I9_E1B19K-      --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
D3GBW3_E1B19K-01        --QRGQRILNYWLIQP-AVPGLLRL---------HRQTSMLEEEMRQAMD
M0QUF3_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QU41_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
F1DT57_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
B2VQE3_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UHZ2_E1B19K-01        --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A3Q9FFS0_E1B19K-      --QRGQRILNYWLIQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1ULJ8_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
E9P585_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UHL7_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A075TSZ1_E1B19K-      --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UHH6_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UKP8_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A291B0H2_E1B19K-      --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
B9A5Q1_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QUB4_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QUJ3_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QUN2_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
C4P207_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
E1CIM6_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
D4N3H6_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QVK6_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QVT4_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
E1AI10_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
H0PPE7_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A3G8WIY5_E1B19K-      --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
Q9YL99_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
A0A384ZUF2_E1B19K-      --QRGQRILNYWLLQP-AAPVLLRL---------HRQTSMLEEEMRQAMD
A0A384ZUM9_E1B19K-      --QRGQRILSYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UHQ8_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
W8VNG2_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLHL---------HRQTSMLEEEMREAMD
F8UFP5_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLHL---------HRQTSMLEEEMREAMD
M0QV87_E1B19K-01        --QRGQRILNYWLLQP-AVPGLLRL---------HRQTSMLEEEMREAMD
M0QU02_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLHL---------HRQTSMLEEEMREAMD
T1UKV6_E1B19K-01        --QRGQRILNYWLLQP-AVPGLLRL---------HRQTSMLEEEMREAMD
M0QV47_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRETMD
M0QUW8_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
E1CIJ0_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
M0QVG6_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
X4YVU5_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
M0QUS9_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
G1FBW4_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
M0QVP5_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
T1UKQ0_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMREAMD
W8CZB0_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
G1FC01_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
G3CK71_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMY
T1UGT5_E1B19K-01        --QRGQRILNYWLLQP-AVPGLLRL---------HRQTSMLEEEMREAMD
T1UK99_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLHL---------HRQTSMLEEEMREAMD
M0QTS5_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
M0QV08_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
G9JUV5_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
T1UGX3_E1B19K-01        --QRGQRILNYWLLQP-AAPGLLRL---------HRQTSMLEEEMRQAMD
Q7T951_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
T1UE63_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
Q8B8U7_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
Q5UW22_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
W6EIX6_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
Q3ZL02_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
T1UFS4_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
A0A7G5F9T0_E1B19K-      --RKMRTILGYWPVQPLGVAGIL-----------RHLPVMPAVLEEEQQE
C7SRS7_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
D2DM83_E1B19K-01        --RKMRTILGYWPVQPLGVAGIL-----------RHPPVMPAVLEEEQQE
T2CI10_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLEEEHQE
A0A0K0PX99_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPAVLEEEQQE
A0A0K0PX35_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPSVLEEEQQE
A0A8B0L9Y2_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPP--PAVLQEEQQE
J7ID56_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
A0A6M6AA96_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
A0A220VZ73_E1B19K-      --RRMRTILNYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
A0A8B0LD36_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
A0A8B0LBX6_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPVVLQEEQQE
R4HLE1_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
R4HMC6_E1B19K-01        --RRMRTILNYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
P03248_E1B19K-02        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
Q2KS85_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPAVLEEEQQE
Q3ZKW2_E1B19K-01        --RSMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLEEEQQE
K7NG43_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPAVLEEEQQE
Q2KRU2_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPAVLEEEQQE
A0A8B0LCV0_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
T1UIP3_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPAMPAVLEEEQQE
R4HLJ6_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
R4HLA0_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
Q2Y0J3_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
A0A5J6CTQ0_E1B19K-      --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
Q5EY83_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
I6LEP5_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
T1UF50_E1B19K-01        --RRMRTILDYWPVQPLGVAGIL-----------RHPPTMPAVLQEEQQE
Q6QPF3_E1B19K-01        --QRLNAISGYLPVQPVDTLRILSLQSPQEHQRRQQPQQEQQQ--EEDRE
Q6QPB7_E1B19K-01        --QRLNAISGYLPVQPVDTLRILSLQSPQEHQRRQQPQQEQQQEEEEDRE
Q6QPI9_E1B19K-01        --QRLNAISGYLPVQPVDTLRILSLQSPQEHQRRQQPQQEQQQ--EEDRE
P10406_E1B19K-01        --QRLNAIPA-------------------TCRYSR---------------
Q5GFC7_E1B19K-02        --QRLNAIPA-------------------TCRYSR---------------
A0A2R3WN62_E1B19K-      --QRLNAIPA-------------------TCRYSR---------------
A0A3G8W6L2_E1B19K-      --QRLNAISGYLPVQPLDTLRILSLQQISQERQRR----QRQ---QEDQE
Q5GFC7_E1B19K-01        --QRLNAISGYLPVQPLDTLRILSL---------------QQ---QEDQE
G9G841_E1B19K-01        --QRLNAISGYLPVQPLDTLKILNLQESPRARQRRRQQQRQQ---EEDQE
Q8UY91_E1B19K-01        --QRLNAISGYLPVQPLDTLRILNLQESPRARQRR--QQQQQ---EEDQE
A0A1L3INW0_E1B19K-      --R---GRKLYGRMLE--R------HPSLIQKTVRAQVLSRWGALENLAE
P06501_E1B19K-01        --R---RVYNYSRGLP--QLGPAA-PLARQGSQQEE-QQQRQEEEQVQE-
A0A0M4N3Z1_E1B19K-      --R---RVYNYSRGLP--QLGPVA-PLVRQGSQQEEQQQQRQEEQQVQEE
Q8B6X5_E1B19K-01        --R---RVYNYSRGLP--QLGPVA-PLVRQGSQQEEQQQQRQEEQQVQEE
H9AAD9_E1B19K-01        --R---RVYNYSRGLP--PLGLAS-VAEERSEESKPEVNPEAQGEAKE--
H9AAH3_E1B19K-01        --R---RVYNYSRGLP--PLGLAS-VAEERSEESKPEVNPEAQGEAKE--
H9AAA8_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQEQK
M9YVA3_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQE--
F2WTJ7_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-LPEEQSPEVKPKVAGQGEEQEQE--
F2WTM9_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-LPEEQSPEVKPKVAGQGEEQEQE--
H9AA76_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEPE--
A0A1C8EG46_E1B19K-      --R---RVYNYSRGLP--PLGRAS-SPEEQLPEVKPEVAGQGEEQEQK--
H9AAN8_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQE--
H9AAS0_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQE--
H9AAV3_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQE--
H9AAY5_E1B19K-01        --R---RVYNYSRGLP--PLGRAS-SPEEQSPEVKPEVAGQGEEQEQE--
F6KST6_E1B19K-01        --KG-RKLYRRLVERH--PSLRQHRLQAQALLRQEELETILEEEAMNMEE
A0A7L4WGT1_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E------------EARRRRRQEQSP
A0A3S9SP19_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A291P1B2_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A5K6WAR5_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E------QQQQQEEARRRRRQEQSP
T1UG63_E1B19K-01        --HK-NRLLLLSSVRP--AIIPTE-E--QQQQQQQQEEARRRRRRQEQSP
A0A6M5E4Y6_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
P03247_E1B19K-01        --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A3G8W3H5_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A516UYI9_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A8F9W8V2_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--------QQQEEARRRRRQEQSP
A0A3S9SND6_E1B19K-      --HK-NRMLLLSSVRP--AIIPTE-E----QQQQQQQEEARRRRRQEQSP
A0A3Q9HJZ5_E1B19K-      --HK-NGLLLLSSVRP--AIIPTE-E--QQQQQQQQQEEARRRRRQEQSP
A0A513TZR1_E1B19K-      --HK-NRMLLLSSVRP--AIIPTE-E--QQQQQQQQQEEARRRRRQEQSP
A0A516UYM9_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E--QQQQQQQQQEEARRRRRQEQSP
A0A7L4WG90_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-EQQQQQQQQQQQEEARRRRRQEQSP
A0A7L4WIG2_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE-E----QQQQQLQEEARRRRRQEQSP
J7I6T8_E1B19K-01        --HK-NRLLLLSSVRP--AIIPTE-E----QQQQQQQEEARRRRRQEQSP
A0A7L4WK62_E1B19K-      --HK-NRMLLLSSVRP--AIIRTE------EQQQQQQEEARRRRRQEQSP
A0A7D0TN91_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE----EQQQQQQQQEEARRRRRQEQSP
A0A3S9SNH4_E1B19K-      --HK-NRMLLLSSVRP--AIIPTE----EQQQQQQQQEEARRRRRQEQSP
Q6WQ37_E1B19K-01        --HK-NRLLLLSSVRP--AIIPTE--------EQQQQQEEARRRRQEQSP
Q6VGV8_E1B19K-01        --HK-NRLLLLSSVRP--AIIPTE--------EQQQQQEEARRRRQEQSP
A0A3Q9HJ54_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE--------EQQQEEARRRRRRQEQSP
A0A3S9SSS2_E1B19K-      --HK-NRLLLLSSVRP--AIPTEE----QQQQQQQQQEEARRRRRQEQSP
A0A3S9SNY0_E1B19K-      --HK-NRLLLLSSVSP--AIIPTE----EQQQQQQQQEEARRRRRQEQSP
A0A2H4PJ75_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE------EQQQQQQEEARRRRRQEQSP
A0A7D6TSN5_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE--EQQQQQQQQQEEARRRRRRQEQSP
Q71BY5_E1B19K-04        --HK-NRLLLLSSVRP--AIIPTE----EQQQQQQQQEEARRRRRQEQSP
A0A4P2SGW2_E1B19K-      --HK-NRLLLLSSVRP--AIIPTE----EQQQQQQQQEEARRRRRQEQSP
A0A7L4WIC2_E1B19K-      --HK-NRLILLSSVRP--AIIPTE--QQQQQQQQQQQEEARRRRRQEQSP
A0A7L4WJT1_E1B19K-      --HK-NRLLLLSSVRP--AIIPTEEQQQQQQQQQQQQEEARRRRRQEQSP
D3JIR7_E1B19K-01        --RR--VCI-YSLARP--LT-MPR-------------LPTLQEEELEQRD
A0A076V686_E1B19K-      --RR--VCI-YSLARP--LT-MPR-------------LPTLQEEP-EERD
A0A5H2QAX5_E1B19K-      --RR--VCI-YSLARP--LT-MPP-------------L-------QEEQQ
G1DE13_E1B19K-01        --RR--VCI-YSLARP--LT-MPP-------------L-------QEEQQ
D0Z5R9_E1B19K-01        --RR--VCI-YSLARP--LT-MPP-------------L-------QEEQQ
T1UEX7_E1B19K-01        --RR--VCI-YSLARP--LT-MPP-------------L-------QEEQQ
A0A3G8WH01_E1B19K-      --RR--VCI-YSLARP--LT-MPP-------------LPTLQEEKEEERN
P04492_E1B19K-01        --RR--VCI-YSLARP--LT-MPP-------------LPTLQEEKEEERN
A0A2H5AI99_E1B19K-      --RK--RVCIYLRAQP--PR-LDR-------------VE---EEDEPVET
A0A0M3TH31_E1B19K-      --RR--RACIYLPVQP--QRGLER-------------VE---EEEE--EN
M9YXY5_E1B19K-01        --RR--RACIYLPVQP--QRGLER-------------VE---EEEE--EN
M9YVF6_E1B19K-01        --RR--RACIYLPVQP--QQGLER-------------VE---EEEE----
A0MK43_E1B19K-01        --RR--VCI-YLRAQP--PR-LDR-------------VV---EENEPEET
A0A2H5AI21_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VV---EENEPEET
A0A0M5L3Y4_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VV---EENEPEET
Q5C8R2_E1B19K-01        --RR--VCI-YLRAQP--PR-LDR-------------VV---EENEPEET
A0A0A1EUB2_E1B19K-      --RR--VCI-YLRAQP--PR-LGR-------------VE---EEDEPGEM
A0A0A1EUC8_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VE---EEDEPGET
A0A2H5AI04_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VE---EEDEPGET
A0A2H5AI72_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VE---EEDEPGET
A0A2H5AIL3_E1B19K-      --RR--VCI-YLRAQP--PR-LDR-------------VE---EEDEPGET
A0A2H4CJZ0_E1B19K-      --KR--RVSGFSPARP--PHGLDP-------------VL---EEPEPEEE
H8PFZ1_E1B19K-01        --KR--RVSGFSPARP--PHGLDP-------------VL---EESELEEE
A0A7U3RVU4_E1B19K-      --RK--RVLGCLPAQR--PHGLDP-------------VQ---EEEEEEEE
A0A142G3J2_E1B19K-      --RK--RVLGCLPAQR--PHGLDP-------------VQ-----EEEEEE
P10543_E1B19K-01        --RK--RVLGCLPAQR--PHGLDP-------------VQ-----EEEEEE
A0A6M6AEV2_E1B19K-      --RK--RVLGCLPAQR--PHGLDP-------------VQ-----EEEEEE
A0A7U3RWV6_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------TV---REEEEEGE
A0A1S6ELT2_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR--EEEEEEEER
A0A3G4W995_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR------EEEEE
A0A898KBW7_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VREEEEEEEEEEE
A0A482EVC6_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR--EEEEEEEEE
P10544_E1B19K-01        --RK--RVLGCSPAQP--PHGLDP-------------VR----EEEEEEE
W0S1G8_E1B19K-01        --RK--RVLGCSPAQP--PHGLDP-------------VR----EEEEEEE
A0A3G8W407_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR-------EEEE
A0A898KBS1_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR---EEEEEEEE
F4ZCJ8_E1B19K-01        --RK--RVLGCSPAQP--PHGLDP-------------VR-EEEEEEEEEE
A0A6M6AES6_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VR-------EEEE
A0A8G1GLF6_E1B19K-      --RK--RVLGCSPAQP--PHGLDP-------------VX-------EEEE
Q71BY5_E1B19K-01        --RAVECIEDLLNEPG-------------------QPLDLSCKRPRP---
Q71BY5_E1B19K-02        --RAVECIEDLLNEPG-------------------QPLDLSCKRPRP---
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        RCRQCECGSSHLELRP-------------------VLLNVT-EELRSDHL
A0A5H2QAX5_E1B19K-      RCRQCECGSSHLELRP-------------------VMLNVT-EELRSDHL
T1UEX7_E1B19K-02        RCRQCECGSSHLELRP-------------------VMLNVT-EELRSDHL
R4HLE1_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
R4HLA0_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
J7ID56_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q5EY83_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
K7NG43_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
T1UIP3_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q2KRU2_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q2KS85_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q3ZKW2_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
R4HLJ6_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
R4HMC6_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q2Y0J3_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
I6LEP5_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
T1UF50_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
Q3ZL02_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
T1UFS4_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
W6EIX6_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
T1UE63_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
A0A7D0TLU2_E1B19K-      RCRPCECGGKHIRNQP-------------------VMLDVT-EELRPDHL
A0A4P2SGW2_E1B19K-      RCRPCECGGKHIRNQP-------------------VMLDVT-EELRPDHL
Q6VGV8_E1B19K-02        RCRPCECGGKHIRNQP-------------------VMLDVT-EELRPDHL
M0QU02_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
J7I6T8_E1B19K-02        RCRPCECGGKHIRNQP-------------------VMLDVT-EELRPDHL
T1UG63_E1B19K-02        RCRPCECGGKHIRNQP-------------------VMLDVT-EELRPDHL
A0A1P8C849_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UGY3_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRADHL
M0QUW8_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QVP5_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QUS9_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UKQ0_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QV47_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
G1FBW4_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
F1DT57_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
E9P585_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UKP8_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
W8CZB0_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1ULJ8_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QUB4_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QVT4_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QVG6_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UK99_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QV87_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UKV6_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
F8UFP5_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EDLRPDHL
T1UGT5_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
C5HDR2_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A3S6PYX7_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A097I4T0_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A384ZUM9_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QUJ3_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UHQ8_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UHH6_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UHL7_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A075TSZ1_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QVK6_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QUN2_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
E1AI10_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A384ZUF2_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
C4P207_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QTS5_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QV08_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QU76_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QU41_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QVC7_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A3Q9FFS0_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UGX3_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
T1UHZ2_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
A0A0G2UY10_E1B19K-      RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
M0QUF3_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
G1FC01_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
G3CK71_E1B19K-02        RVRACECGGRHTRMQP-------------------VALDVT-EELRPDHL
Q5GFC7_E1B19K-03        RCRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
I6LEP5_E1B19K-03        RVRACECGGKHARFQP-------------------VCVDVT-EDLRPDHL
T2CI10_E1B19K-02        RVRACECGGKHARFQP-------------------VCVDVT-EELRPDHL
P04492_E1B19K-02        RCRQCECGSSHLELRP-------------------IVLNVT-EELRSDHL
A0MK43_E1B19K-02        RCRSCECGANHLRLYP-------------------VTLNVT-EELRTDHH
A0A482EVC6_E1B19K-      RCRPCECGANHIRLYP-------------------ATLNVT-EQLRTDHQ
Q71BY5_E1B19K-03        QNRNLQDLPGVLKW------------------------------------
Q5EY83_E1B19K-03        RVRACECGGKHARF--------------------QPVCVDVTEDLRPDHL
Q5GFC7_E1B19K-05        ECNLRLLAGTAARHSE------------------DPESPAAGGSRRESES
                                                                          

Q5GFC7_E1B19K-04        D--------------------------------------
A0A0M4NHE0_E1B19K-      E----------------ALRSGLDPPVEED---------
H9AAK5_E1B19K-01        E----------------TLRSGLDPPVEEN---------
G0ZAH2_E1B19K-01        EGEMTTSIWRPSMEAEWPPRAGMDPPLEEQWEADHDPEA
A0A3Q9HK78_E1B19K-      E------------QSPWNPRAGLDPRE------------
A0A3S9SPV1_E1B19K-      E------------QSPWNPRAGLDPRE------------
A0A1W5PVU4_E1B19K-      E----------------EPRAGMDPPSET----------
A0A0M3TH18_E1B19K-      E----------------EPRAGTDPPSET----------
A0A097IW62_E1B19K-      E----------------NPRAGMDPPSEN----------
A0A0A1EUE4_E1B19K-      E----------------NLRAGLDPPMED----------
A0A2H5AI40_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AID8_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AII9_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIL0_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIN5_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIS9_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIT6_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIU0_E1B19K-      E----------------NLRAGLDPPVED----------
A0A2H5AIC5_E1B19K-      E----------------NLRAGLDPPVED----------
A0A0G2UY10_E1B19K-      E----------------NPRSGLDPPSEEELD-------
X4Y9D2_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
C5HDR2_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QVC7_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A3S6PYX7_E1B19K-      E----------------NPRSGLDPPSEEELD-------
Q4KSL0_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A1P8C849_E1B19K-      K----------------NPRSGLDPPSEEELD-------
T1UGY3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
H5T740_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A1J0MS84_E1B19K-      E----------------NPRSGLDPPSEEELD-------
A0A097I4T0_E1B19K-      E----------------NPRSGLDPPPEEELD-------
E5RWD9_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QU76_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A7R6T9I9_E1B19K-      E----------------NPRSGLDPPSEEELN-------
D3GBW3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUF3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QU41_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
F1DT57_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
B2VQE3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UHZ2_E1B19K-01        E----------------NPRSGLDPPSEEELN-------
A0A3Q9FFS0_E1B19K-      E----------------NPRSGLDPPSEEELD-------
T1ULJ8_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
E9P585_E1B19K-01        E----------------NPRSGLDPPLEEELD-------
T1UHL7_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A075TSZ1_E1B19K-      E----------------NPRSGLDPPSEEELD-------
T1UHH6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UKP8_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A291B0H2_E1B19K-      E----------------NPRSGLDPPSEEELD-------
B9A5Q1_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUB4_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUJ3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUN2_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
C4P207_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
E1CIM6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
D4N3H6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QVK6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QVT4_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
E1AI10_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
H0PPE7_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A3G8WIY5_E1B19K-      E----------------NPRSGLDPPSEEELD-------
Q9YL99_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
A0A384ZUF2_E1B19K-      E----------------NPRSGLDPPSEEELD-------
A0A384ZUM9_E1B19K-      E----------------NPRSGLDPPSEEELD-------
T1UHQ8_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
W8VNG2_E1B19K-01        D----------------NPRSGLDPPSEEELD-------
F8UFP5_E1B19K-01        D----------------NPRSGLDPPSEEELD-------
M0QV87_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QU02_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UKV6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QV47_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUW8_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
E1CIJ0_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QVG6_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
X4YVU5_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QUS9_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
G1FBW4_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QVP5_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UKQ0_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
W8CZB0_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
G1FC01_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
G3CK71_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UGT5_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UK99_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QTS5_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
M0QV08_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
G9JUV5_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
T1UGX3_E1B19K-01        E----------------NPRSGLDPPSEEELD-------
Q7T951_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
T1UE63_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
Q8B8U7_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
Q5UW22_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
W6EIX6_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
Q3ZL02_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
T1UFS4_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
A0A7G5F9T0_E1B19K-      D----------------NPRAGLDPPVEEAE--------
C7SRS7_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
D2DM83_E1B19K-01        D----------------NPRAGLDPPVEEAE--------
T2CI10_E1B19K-01        D----------------NPRVGLDPPVEEAEE-------
A0A0K0PX99_E1B19K-      D----------------NPRAGLDPPVEEAEE-------
A0A0K0PX35_E1B19K-      D----------------NPRAGLDPPVEEAEE-------
A0A8B0L9Y2_E1B19K-      D----------------NPRAGLDPPVEE----------
J7ID56_E1B19K-01        D----------------NPRAGLDPPVEE----------
A0A6M6AA96_E1B19K-      D----------------NPRAGLDPPVEE----------
A0A220VZ73_E1B19K-      D----------------NPRAGLDPPVEE----------
A0A8B0LD36_E1B19K-      D----------------NPRAGLDPPVEE----------
A0A8B0LBX6_E1B19K-      D----------------NPRAGLDPPVEE----------
R4HLE1_E1B19K-01        D----------------NPRAGLDPPVEE----------
R4HMC6_E1B19K-01        D----------------NPRAGLDPPVEE----------
P03248_E1B19K-02        D----------------NPRAGLDPPVEE----------
Q2KS85_E1B19K-01        D----------------NPRAGLDPPVEE----------
Q3ZKW2_E1B19K-01        D----------------NPRAGLDPPVEE----------
K7NG43_E1B19K-01        D----------------NPRAGLDPPVEE----------
Q2KRU2_E1B19K-01        D----------------NPRAGLDPPVEE----------
A0A8B0LCV0_E1B19K-      D----------------NPRAGLDPPVEE----------
T1UIP3_E1B19K-01        D----------------NPRAGLDPPVEE----------
R4HLJ6_E1B19K-01        D----------------NPRAGLDPPVEE----------
R4HLA0_E1B19K-01        D----------------NPRAGLDPPVEE----------
Q2Y0J3_E1B19K-01        D----------------NPRAGLDPPVEE----------
A0A5J6CTQ0_E1B19K-      D----------------NPRAGLDPPVEE----------
Q5EY83_E1B19K-01        D----------------NPRAGLDPPVEE----------
I6LEP5_E1B19K-01        D----------------NPRAGLDPPVEE----------
T1UF50_E1B19K-01        D----------------NPRAGLDPPVEE----------
Q6QPF3_E1B19K-01        E----------------NPRAGLDPPVAEEEE-------
Q6QPB7_E1B19K-01        E----------------NPRAGLDPPVAEEEE-------
Q6QPI9_E1B19K-01        E----------------NLRAGLDPPVAEEEE-------
P10406_E1B19K-01        ---------------------------------------
Q5GFC7_E1B19K-02        ---------------------------------------
A0A2R3WN62_E1B19K-      ---------------------------------------
A0A3G8W6L2_E1B19K-      E----------------NPRAGLDPPAEEEE--------
Q5GFC7_E1B19K-01        E----------------NPRAGLDPPAEE----------
G9G841_E1B19K-01        E----------------NPRAGLDPPAEEE---------
Q8UY91_E1B19K-01        E----------------NPRAGLDPPAEEEE--------
A0A1L3INW0_E1B19K-      E----------------DPRAGLDPP-EEEVD-------
P06501_E1B19K-01        -----------------EMRSGLDPP-TEN---------
A0A0M4N3Z1_E1B19K-      G----------------EMRSGLDPP-TEN---------
Q8B6X5_E1B19K-01        G----------------EMRSGLDPP-TEN---------
H9AAD9_E1B19K-01        E----------------TLRSGLDPPVEEN---------
H9AAH3_E1B19K-01        E----------------TLRSGLNPPVEEN---------
H9AAA8_E1B19K-01        P----------------ALRSGLDPP-EEN---------
M9YVA3_E1B19K-01        P----------------ALRSGLDPP-EEN---------
F2WTJ7_E1B19K-01        P----------------ALRSGLDPP-EEKED-------
F2WTM9_E1B19K-01        P----------------ALRSGLDPP-EEKED-------
H9AA76_E1B19K-01        P----------------ALRSGLDPP-EEN---------
A0A1C8EG46_E1B19K-      P----------------ALRSGLGPP-EEN---------
H9AAN8_E1B19K-01        P----------------ALRSGLDPP-EEN---------
H9AAS0_E1B19K-01        P----------------ALRSGLDPP-EEN---------
H9AAV3_E1B19K-01        P----------------ALRSGLDPP-EEN---------
H9AAY5_E1B19K-01        P----------------ALRSGLDPP-EEN---------
F6KST6_E1B19K-01        Q----------------NPRAGLDPP-VEA---------
A0A7L4WGT1_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3S9SP19_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A291P1B2_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A5K6WAR5_E1B19K-      W----------------NPRAGLDPR-E-----------
T1UG63_E1B19K-01        W----------------NPRAGLDPR-E-----------
A0A6M5E4Y6_E1B19K-      W----------------NPRAGLDPR-E-----------
P03247_E1B19K-01        W----------------NPRAGLDPR-E-----------
A0A3G8W3H5_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A516UYI9_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A8F9W8V2_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3S9SND6_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3Q9HJZ5_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A513TZR1_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A516UYM9_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7L4WG90_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7L4WIG2_E1B19K-      W----------------NPRAGLDPR-E-----------
J7I6T8_E1B19K-01        W----------------NPRAGLDPR-E-----------
A0A7L4WK62_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7D0TN91_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3S9SNH4_E1B19K-      W----------------NPRAGLDPR-E-----------
Q6WQ37_E1B19K-01        W----------------NPRAGLDPR-E-----------
Q6VGV8_E1B19K-01        W----------------NPRAGLDPR-E-----------
A0A3Q9HJ54_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3S9SSS2_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A3S9SNY0_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A2H4PJ75_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7D6TSN5_E1B19K-      W----------------NPRAGLDPR-E-----------
Q71BY5_E1B19K-04        W----------------NPRAGLDPR-E-----------
A0A4P2SGW2_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7L4WIC2_E1B19K-      W----------------NPRAGLDPR-E-----------
A0A7L4WJT1_E1B19K-      W----------------NPRAGLDPR-E-----------
D3JIR7_E1B19K-01        P----------------AAEK------------------
A0A076V686_E1B19K-      P----------------AVEK------------------
A0A5H2QAX5_E1B19K-      N----------------TTTEE-----------------
G1DE13_E1B19K-01        N----------------TTTEE-----------------
D0Z5R9_E1B19K-01        N----------------TTTEE-----------------
T1UEX7_E1B19K-01        N----------------TTTEE-----------------
A0A3G8WH01_E1B19K-      P----------------AVVEK-----------------
P04492_E1B19K-01        P----------------AVVEK-----------------
A0A2H5AI99_E1B19K-      D----------------NPRAGLDPPVED----------
A0A0M3TH31_E1B19K-      E----------------NPRAGVDPPLE-----------
M9YXY5_E1B19K-01        E----------------NPRAGVDPPLE-----------
M9YVF6_E1B19K-01        E----------------NPRAGVDPPLE-----------
A0MK43_E1B19K-01        E----------------NLRAGLDPPVED----------
A0A2H5AI21_E1B19K-      E----------------NLRAGLDPPVED----------
A0A0M5L3Y4_E1B19K-      E----------------NLRAGLDPPVED----------
Q5C8R2_E1B19K-01        E----------------NLRAGLDPPVED----------
A0A0A1EUB2_E1B19K-      E----------------NLRAGLDPPTED----------
A0A0A1EUC8_E1B19K-      E----------------NLRAGLDPPTED----------
A0A2H5AI04_E1B19K-      E----------------NLRAGLDPPTED----------
A0A2H5AI72_E1B19K-      E----------------NLRAGLDPPTED----------
A0A2H5AIL3_E1B19K-      E----------------NLRAGLDPPTED----------
A0A2H4CJZ0_E1B19K-      E----------------NPRAGLDPSAE-----------
H8PFZ1_E1B19K-01        E----------------NPRAGLDPPAE-----------
A0A7U3RVU4_E1B19K-      E----------------NLRAGLDPSTEL----------
A0A142G3J2_E1B19K-      E----------------NLRAGLDPSTEL----------
P10543_E1B19K-01        E----------------NLRAGLDPSTEL----------
A0A6M6AEV2_E1B19K-      E----------------NLRAGLDPSTEL----------
A0A7U3RWV6_E1B19K-      E----------------N---------------------
A0A1S6ELT2_E1B19K-      E----------------NLRAGLDPQTEL----------
A0A3G4W995_E1B19K-      E----------------NLRAGLDPQTEL----------
A0A898KBW7_E1B19K-      E----------------NLRAGLDPQTEL----------
A0A482EVC6_E1B19K-      E----------------NLRAGLDPQTEL----------
P10544_E1B19K-01        E----------------NLRAGLDPQTEL----------
W0S1G8_E1B19K-01        E----------------NLRAGLDPQTEL----------
A0A3G8W407_E1B19K-      E----------------NLRAGLDPQTEL----------
A0A898KBS1_E1B19K-      E----------------NLRAGLDPQTEL----------
F4ZCJ8_E1B19K-01        E----------------NLRAGLDPQTEL----------
A0A6M6AES6_E1B19K-      E----------------NLRAGLDPQTEL----------
A0A8G1GLF6_E1B19K-      E----------------NLRAGLDPQTEL----------
Q71BY5_E1B19K-01        ---------------------------------------
Q71BY5_E1B19K-02        ---------------------------------------
P03248_E1B19K-03        ---------------------------------------
D3JIR7_E1B19K-02        T----------------LSCLRTDYESSDEDGN------
A0A5H2QAX5_E1B19K-      T----------------LSCLRTDYDSSDEDN-------
T1UEX7_E1B19K-02        T----------------LSCLRTDYESSDEDN-------
R4HLE1_E1B19K-02        V----------------LACTGAEFGSSGEETD------
R4HLA0_E1B19K-02        V----------------LACTGAEFGSSGEETD------
J7ID56_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q5EY83_E1B19K-02        V----------------LACTGAEFGSSGEETD------
K7NG43_E1B19K-02        V----------------LACTGAEFGSSGEETD------
T1UIP3_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q2KRU2_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q2KS85_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q3ZKW2_E1B19K-02        V----------------LACTGAEFGSSGEETD------
R4HLJ6_E1B19K-02        V----------------LACTGAEFGSSGEETD------
R4HMC6_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q2Y0J3_E1B19K-02        V----------------LACTGAEFGSSGEETD------
I6LEP5_E1B19K-02        V----------------LACTGAEFGSSGEETD------
T1UF50_E1B19K-02        V----------------LACTGAEFGSSGEETD------
Q3ZL02_E1B19K-02        V----------------IARTGAEFGSSGEETD------
T1UFS4_E1B19K-02        V----------------IARTGAEFGSSGEETD------
W6EIX6_E1B19K-02        V----------------IARTGAEFGSSGEETD------
T1UE63_E1B19K-02        V----------------IARTGAEFGSSGEETD------
A0A7D0TLU2_E1B19K-      V----------------LACTRAEFGSSDEDTD------
A0A4P2SGW2_E1B19K-      V----------------LACTRAEFGSSDEDTD------
Q6VGV8_E1B19K-02        V----------------LACTRAEFGSSDEDTD------
M0QU02_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
J7I6T8_E1B19K-02        V----------------LACTRAEFGSSDEDTD------
T1UG63_E1B19K-02        V----------------LACTRAEFGSSDEDTD------
A0A1P8C849_E1B19K-      V----------------MACTGTEFSSSGEDTD------
T1UGY3_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QUW8_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QVP5_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QUS9_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UKQ0_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QV47_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
G1FBW4_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
F1DT57_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
E9P585_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UKP8_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
W8CZB0_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1ULJ8_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QUB4_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QVT4_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QVG6_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UK99_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QV87_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UKV6_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
F8UFP5_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UGT5_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
C5HDR2_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
A0A3S6PYX7_E1B19K-      V----------------MACTGTEFSSSGEDTD------
A0A097I4T0_E1B19K-      V----------------MACTGTEFSSSGEDTD------
A0A384ZUM9_E1B19K-      V----------------MACTGTEFSSSGEDTD------
M0QUJ3_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UHQ8_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UHH6_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UHL7_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
A0A075TSZ1_E1B19K-      V----------------MACTGTEFSSSGEDTD------
M0QVK6_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QUN2_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
E1AI10_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
A0A384ZUF2_E1B19K-      V----------------MACTGTEFSSSGEDTD------
C4P207_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QTS5_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QV08_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QU76_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QU41_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
M0QVC7_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
A0A3Q9FFS0_E1B19K-      V----------------MACTGTEFSSSGEDTD------
T1UGX3_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
T1UHZ2_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
A0A0G2UY10_E1B19K-      V----------------MACTGTEFSSSGEDTD------
M0QUF3_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
G1FC01_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
G3CK71_E1B19K-02        V----------------MACTGTEFSSSGEDTD------
Q5GFC7_E1B19K-03        V----------------LSCTGTEFGSSGEESD------
I6LEP5_E1B19K-03        V----------------LACTGAEFGSSGEETD------
T2CI10_E1B19K-02        V----------------IACTGAEFGSSGEETD------
P04492_E1B19K-02        T----------------LSCLRTDYESSDEDDN------
A0MK43_E1B19K-02        M----------------LSCLRTDYESSDEE--------
A0A482EVC6_E1B19K-      M----------------LSCLRTDYESSDED--------
Q71BY5_E1B19K-03        -----------------------------CLLS------
Q5EY83_E1B19K-03        V----------------LACTGAEFGSSGEETD------
Q5GFC7_E1B19K-05        R----------------PGPSGGGVADLPCVWM------
                                                               

© 1998-2022Legal notice