Dataset for protein E1B 19K of organism all

[Download (right click)] [Sequences] [Repertoires]

417 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


Q7T8D8_E1B19K-03          -------------------------------------------------M
Q6RK98_E1B19K-03          -------------------------------------------------M
P04492_E1B19K-02          -------------------------------------------------M
Q2KSM8_E1B19K-01          -------------------------------------------------M
M9YVF6_E1B19K-01          -------------------------------------------------M
T2CI10_E1B19K-01          -------------------------------------------------M
A0A1W5PVU4_E1B19K-01      MMKR-------P---------------------------VA----AEVQM
A0A3Q9HK00_E1B19K-01      MFNL-------HGV---L----NGA---GLKGYIM-RRGLILV--TFDLM
A0A9X9PKC1_E1B19K-01      -------------------------------------------------M
A0A5K6WAR5_E1B19K-01      -------------------------------------------------M
T2CI10_E1B19K-02          -------------------------------------------------M
A0A2H5AIC5_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A0M4N3Z1_E1B19K-01      -------------------------------------------------M
A0A3S9SPV1_E1B19K-01      MFNL-------HGV---L----NGA---GLKGYIM-RRGLILV--TFDLM
A0A9W3HRK4_E1B19K-02      -------------------------------------------------M
A0A7L4WJT1_E1B19K-01      -------------------------------------------------M
D3JIR7_E1B19K-02          -------------------------------------------------M
Q2KSM8_E1B19K-03          -------------------------------------------------M
A0A7U3RVU4_E1B19K-01      -------------------------------------------------M
F2WTM9_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAAV---GLG-----HFTM
A0A0M4NHE0_E1B19K-01      MINCCELWLFIQRV---LPGRYKGS---GFQ-----ARGIYP---LAAFM
A0A2H4PJ75_E1B19K-01      -------------------------------------------------M
G0ZAH2_E1B19K-01          -------------------------------------------------M
P10406_E1B19K-01          -------------------------------------------------M
M0QU02_E1B19K-02          -------------------------------------------------M
J9Z4H6_E1B19K-02          -------------------------------------------------M
P04492_E1B19K-01          -------------------------------------------------M
A0A898KBW7_E1B19K-01      -------------------------------------------------M
A0A7L4WG90_E1B19K-01      -------------------------------------------------M
A0A3S9SND6_E1B19K-01      -------------------------------------------------M
J7I6T8_E1B19K-02          -------------------------------------------------M
A0A5H2QAX5_E1B19K-01      -------------------------------------------------M
Q6QPB7_E1B19K-01          -------------------------------------------------M
A0A8G1GLF6_E1B19K-01      -------------------------------------------------M
T1UG63_E1B19K-02          -------------------------------------------------M
A0A3Q9HJ63_E1B19K-01      -------------------------------------------------M
T1UEX7_E1B19K-02          -------------------------------------------------M
F6KST6_E1B19K-01          -------------------------------------------------M
A0A482EVC6_E1B19K-02      -------------------------------------------------M
A0A3Q9HK78_E1B19K-01      MFNL-------HGV---L----NGA---GLKGYIM-RRGLILV--TFDLM
H9AAA8_E1B19K-01          -------------------------------------------------M
A0MK43_E1B19K-02          -------------------------------------------------M
Q32UI6_E1B19K-02          -------------------------------------------------M
A0A3S6PYX7_E1B19K-01      MTHG-------RG----------------LVLYKWQHLGTWAQTFREFLM
Q5GFC7_E1B19K-03          -------------------------------------------------M
A0A3Q9HJ54_E1B19K-01      -------------------------------------------------M
A0A898KBR0_E1B19K-01      -------------------------------------------------M
J9Z4N4_E1B19K-01          -------------------------------------------------M
P10544_E1B19K-01          -------------------------------------------------M
F4ZCJ8_E1B19K-01          -------------------------------------------------M
Q8UY91_E1B19K-01          -------------------------------------------------M
A0A9W3I4N3_E1B19K-01      -------------------------------------------------M
A0A1L3INW0_E1B19K-01      -------------------------------------------------M
A0A097IW62_E1B19K-01      -------------------------------------------------M
A0A3G4W995_E1B19K-01      -------------------------------------------------M
A0A7D0TLU2_E1B19K-01      MFNL-------HGV---L----YGT---GLLGHIM-RRGLILV--TSDLM
G9G841_E1B19K-01          -------------------------------------------------M
Q6VGV8_E1B19K-02          -------------------------------------------------M
P06501_E1B19K-01          -------------------------------------------------M
Q71BY5_E1B19K-01          -------------------------------------------------M
Q71BY5_E1B19K-03          -------------------------------------------------M
Q5GFC7_E1B19K-05          -------------------------------------------------M
E1ARN8_E1B19K-03          -------------------------------------------------M
Q2KSG6_E1B19K-05          -------------------------------------------------M
Q2KSM8_E1B19K-05          -------------------------------------------------M
Q2KSM8_E1B19K-04          -------------------------------------------------M
Q5GFC7_E1B19K-04          -------------------------------------------------M
E1ARN8_E1B19K-04          -------------------------------------------------M
E1U5L6_E1B19K-04          -------------------------------------------------M
A0A1C8EG46_E1B19K-01      MIND-------VNFVCLF----KGDYLGGIKGAVV---RLG-----HFTM
W6EIX6_E1B19K-01          -------------------------------------------------M
W6EIX6_E1B19K-02          -------------------------------------------------M
Q7T8D8_E1B19K-01          -------------------------------------------------M
Q7T8D8_E1B19K-02          -------------------------------------------------M
Q8B8U7_E1B19K-01          -------------------------------------------------M
Q32UI6_E1B19K-01          -------------------------------------------------M
B9A5Q1_E1B19K-01          -------------------------------------------------M
B9A5T7_E1B19K-01          -------------------------------------------------M
M0QU76_E1B19K-01          -------------------------------------------------M
M0QU76_E1B19K-02          -------------------------------------------------M
A0A0B4SJH1_E1B19K-01      -------------------------------------------------M
A0A0B4SJH1_E1B19K-02      -------------------------------------------------M
Q2KS85_E1B19K-01          -------------------------------------------------M
Q2KS85_E1B19K-02          -------------------------------------------------M
C5HDR2_E1B19K-01          MTHG-------RG----------------LVLYKWQHLGTWAQTFREFLM
C5HDR2_E1B19K-02          -------------------------------------------------M
D3GBW3_E1B19K-01          -------------------------------------------------M
M0QUB4_E1B19K-02          -------------------------------------------------M
W8CZB0_E1B19K-01          -------------------------------------------------M
W8CZB0_E1B19K-02          -------------------------------------------------M
M0QUF3_E1B19K-01          -------------------------------------------------M
M0QUF3_E1B19K-02          -------------------------------------------------M
M0QUJ3_E1B19K-01          -------------------------------------------------M
M0QUJ3_E1B19K-02          -------------------------------------------------M
M0QUN2_E1B19K-02          -------------------------------------------------M
C4P207_E1B19K-02          -------------------------------------------------M
R4HLJ6_E1B19K-01          -------------------------------------------------M
R4HLJ6_E1B19K-02          -------------------------------------------------M
M0QTS5_E1B19K-01          -------------------------------------------------M
M0QTS5_E1B19K-02          -------------------------------------------------M
M0QUS9_E1B19K-01          -------------------------------------------------M
M0QUS9_E1B19K-02          -------------------------------------------------M
Q3ZL02_E1B19K-01          -------------------------------------------------M
Q3ZL02_E1B19K-02          -------------------------------------------------M
M0QV47_E1B19K-01          -------------------------------------------------M
M0QV47_E1B19K-02          -------------------------------------------------M
M0QV87_E1B19K-01          -------------------------------------------------M
M0QV87_E1B19K-02          -------------------------------------------------M
M0QVC7_E1B19K-01          MTHG-------RG----------------LVLYKWQHLGTGAQTFRKFLM
M0QVC7_E1B19K-02          -------------------------------------------------M
M0QVG6_E1B19K-01          -------------------------------------------------M
M0QVG6_E1B19K-02          -------------------------------------------------M
M0QVK6_E1B19K-02          -------------------------------------------------M
M0QVP5_E1B19K-01          -------------------------------------------------M
M0QVP5_E1B19K-02          -------------------------------------------------M
Q4KSL0_E1B19K-01          MTHG-------RG----------------LVLYKWQHLGTGAQTFREFLM
M0QUW8_E1B19K-01          -------------------------------------------------M
M0QUW8_E1B19K-02          -------------------------------------------------M
A0A3G9JTX5_E1B19K-01      -------------------------------------------------M
A0A3G9K5X3_E1B19K-01      -------------------------------------------------M
A0A3G9CMQ4_E1B19K-01      -------------------------------------------------M
Q3ZKW2_E1B19K-01          -------------------------------------------------M
Q3ZKW2_E1B19K-02          -------------------------------------------------M
M0QVT4_E1B19K-02          -------------------------------------------------M
A0MK43_E1B19K-01          -------------------------------------------------M
A0A3Q9FFS0_E1B19K-01      -------------------------------------------------M
A0A3Q9FFS0_E1B19K-02      -------------------------------------------------M
E5RWD9_E1B19K-01          -------------------------------------------------M
B9A5L5_E1B19K-01          -------------------------------------------------M
A0A7G5F9T0_E1B19K-01      -------------------------------------------------M
A0A7G5FB98_E1B19K-01      -------------------------------------------------M
A0A7G5FB98_E1B19K-02      -------------------------------------------------M
C7SRS7_E1B19K-01          -------------------------------------------------M
A0A1Y1BXT7_E1B19K-01      -------------------------------------------------M
E9P585_E1B19K-01          -------------------------------------------------M
E9P585_E1B19K-02          -------------------------------------------------M
G1FC01_E1B19K-02          -------------------------------------------------M
G1DE13_E1B19K-01          -------------------------------------------------M
G1FBW4_E1B19K-01          -------------------------------------------------M
G1FBW4_E1B19K-02          -------------------------------------------------M
R4HLA0_E1B19K-02          -------------------------------------------------M
H5T740_E1B19K-01          -------------------------------------------------M
K7NG43_E1B19K-02          -------------------------------------------------M
T1UHL7_E1B19K-01          -------------------------------------------------M
T1UHL7_E1B19K-02          -------------------------------------------------M
R4HMC6_E1B19K-01          -------------------------------------------------M
R4HMC6_E1B19K-02          -------------------------------------------------M
W8VNG2_E1B19K-01          -------------------------------------------------M
A0A3G8WH01_E1B19K-01      -------------------------------------------------M
D3JIR7_E1B19K-01          -------------------------------------------------M
A0A5H2QAX5_E1B19K-02      -------------------------------------------------M
D0Z5R9_E1B19K-01          -------------------------------------------------M
Q2KRU2_E1B19K-02          -------------------------------------------------M
R4HLE1_E1B19K-01          -------------------------------------------------M
R4HLE1_E1B19K-02          -------------------------------------------------M
Q7T951_E1B19K-01          -------------------------------------------------M
A0A8B0L9Y2_E1B19K-01      -------------------------------------------------M
A0A8B0LBX6_E1B19K-01      -------------------------------------------------M
A0A8B0LCV0_E1B19K-01      -------------------------------------------------M
A0A8B0LD36_E1B19K-01      -------------------------------------------------M
Q2Y0J3_E1B19K-01          -------------------------------------------------M
Q2Y0J3_E1B19K-02          -------------------------------------------------M
A0A220VZ73_E1B19K-01      -------------------------------------------------M
P03248_E1B19K-03          -------------------------------------------------M
P03248_E1B19K-02          -------------------------------------------------M
Q5EY83_E1B19K-01          -------------------------------------------------M
Q5EY83_E1B19K-02          -------------------------------------------------M
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          -------------------------------------------------M
A0A7D6TSN5_E1B19K-01      -------------------------------------------------M
Q71BY5_E1B19K-02          -------------------------------------------------M
Q71BY5_E1B19K-04          -------------------------------------------------M
A0A1U9ALK7_E1B19K-01      -------------------------------------------------M
A0A4P2SGW2_E1B19K-02      -------------------------------------------------M
P03246_E1B19K-01          -------------------------------------------------M
Q6WQ37_E1B19K-01          -------------------------------------------------M
E1U5L6_E1B19K-02          -------------------------------------------------M
E1U5L6_E1B19K-03          -------------------------------------------------M
F1DT57_E1B19K-01          -------------------------------------------------M
F1DT57_E1B19K-02          -------------------------------------------------M
A0A1P7YWR9_E1B19K-01      -------------------------------------------------M
A0A1P7YWR9_E1B19K-02      -------------------------------------------------M
A0A1P7YWY2_E1B19K-02      -------------------------------------------------M
A0A1P7YWY2_E1B19K-01      -------------------------------------------------M
A0A1P7YXN8_E1B19K-01      -------------------------------------------------M
A0A1P7YYY5_E1B19K-02      -------------------------------------------------M
A0A1P7YYY5_E1B19K-01      -------------------------------------------------M
A0A1P8C849_E1B19K-01      -------------------------------------------------M
B9A5A7_E1B19K-01          -------------------------------------------------M
M0QU02_E1B19K-01          -------------------------------------------------M
A0A3G8W6L2_E1B19K-01      -------------------------------------------------M
Q2KSG6_E1B19K-02          -------------------------------------------------M
Q2KSG6_E1B19K-04          -------------------------------------------------M
Q2KSG6_E1B19K-03          -------------------------------------------------M
Q5GFC7_E1B19K-02          -------------------------------------------------M
A0A142G3J2_E1B19K-01      -------------------------------------------------M
P10543_E1B19K-01          -------------------------------------------------M
A0A1S6ELT2_E1B19K-01      -------------------------------------------------M
A0A3G8W407_E1B19K-01      -------------------------------------------------M
A0A482EVC6_E1B19K-01      -------------------------------------------------M
A0A7U3RWV6_E1B19K-01      -------------------------------------------------M
A0A898KBS1_E1B19K-01      -------------------------------------------------M
A0A513TZR1_E1B19K-01      -------------------------------------------------M
A0A516UYM9_E1B19K-01      -------------------------------------------------M
A0A0K0PX35_E1B19K-01      -------------------------------------------------M
A0A0K0PX99_E1B19K-01      -------------------------------------------------M
A0A6M6AA96_E1B19K-01      -------------------------------------------------M
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          -------------------------------------------------M
J7ID56_E1B19K-01          -------------------------------------------------M
T1UE63_E1B19K-02          -------------------------------------------------M
T1UF50_E1B19K-01          -------------------------------------------------M
T1UIP3_E1B19K-02          -------------------------------------------------M
T1UJX4_E1B19K-01          -------------------------------------------------M
T1UJX4_E1B19K-02          -------------------------------------------------M
A0A291P1B2_E1B19K-01      -------------------------------------------------M
A0A3Q9HJZ5_E1B19K-01      -------------------------------------------------M
A0A3Q9HLF7_E1B19K-01      -------------------------------------------------M
A0A3S9SNH4_E1B19K-01      -------------------------------------------------M
A0A3S9SNY0_E1B19K-01      -------------------------------------------------M
A0A3S9SP19_E1B19K-01      -------------------------------------------------M
A0A3S9SSS2_E1B19K-01      -------------------------------------------------M
A0A6M4W5T4_E1B19K-01      -------------------------------------------------M
A0A7D0TN91_E1B19K-01      ----------------------------------M-RRGLILV--TSDLM
A0A7L4WGT1_E1B19K-01      -------------------------------------------------M
A0A7L4WIC2_E1B19K-01      -------------------------------------------------M
A0A7L4WIG2_E1B19K-01      -------------------------------------------------M
A0A7L4WK62_E1B19K-01      -------------------------------------------------M
A0A8F9W8V2_E1B19K-01      -------------------------------------------------M
E1ARN8_E1B19K-02          -------------------------------------------------M
J7I6T8_E1B19K-01          -------------------------------------------------M
J9Z4N4_E1B19K-02          -------------------------------------------------M
T1UG63_E1B19K-01          -------------------------------------------------M
A0A075TSZ1_E1B19K-01      -------------------------------------------------M
A0A097I4T0_E1B19K-01      -------------------------------------------------M
A0A097I4T0_E1B19K-02      -------------------------------------------------M
A0A0G2UY10_E1B19K-01      MTHG-------RG----------------LVLYKWQHLGTWAQTFREFLM
A0A0G2UY10_E1B19K-02      -------------------------------------------------M
A0A1J0MS84_E1B19K-01      -------------------------------------------------M
A0A291B0H2_E1B19K-01      -------------------------------------------------M
A0A384ZUF2_E1B19K-01      -------------------------------------------------M
A0A384ZUM9_E1B19K-01      -------------------------------------------------M
A0A384ZUM9_E1B19K-02      -------------------------------------------------M
F8UFP5_E1B19K-02          -------------------------------------------------M
F8UFP5_E1B19K-01          -------------------------------------------------M
G3CK71_E1B19K-02          -------------------------------------------------M
G3CK71_E1B19K-01          -------------------------------------------------M
T1UG22_E1B19K-02          -------------------------------------------------M
T1UGT5_E1B19K-02          -------------------------------------------------M
T1UGT5_E1B19K-01          -------------------------------------------------M
T1UGU0_E1B19K-02          -------------------------------------------------M
T1UGX3_E1B19K-02          -------------------------------------------------M
T1UGX3_E1B19K-01          -------------------------------------------------M
T1UGY3_E1B19K-02          -------------------------------------------------M
T1UHG3_E1B19K-02          -------------------------------------------------M
T1UHG3_E1B19K-01          -------------------------------------------------M
T1UHH6_E1B19K-02          -------------------------------------------------M
T1UHH6_E1B19K-01          -------------------------------------------------M
T1UHQ8_E1B19K-01          -------------------------------------------------M
T1UHQ8_E1B19K-02          -------------------------------------------------M
T1UHZ2_E1B19K-02          -------------------------------------------------M
T1UK99_E1B19K-01          -------------------------------------------------M
T1UK99_E1B19K-02          -------------------------------------------------M
T1UKP8_E1B19K-02          -------------------------------------------------M
T1UKQ0_E1B19K-02          -------------------------------------------------M
T1UKQ0_E1B19K-01          -------------------------------------------------M
T1UKV6_E1B19K-01          -------------------------------------------------M
T1UKV6_E1B19K-02          -------------------------------------------------M
T1ULJ8_E1B19K-02          -------------------------------------------------M
T1ULJ8_E1B19K-01          -------------------------------------------------M
T1ULP4_E1B19K-02          -------------------------------------------------M
X4Y9D2_E1B19K-01          MTHG-------RG----------------LVLYKWQHLGTRAQTFREFLM
A0A0A1EUB2_E1B19K-01      -------------------------------------------------M
A0A0A1EUC8_E1B19K-01      -------------------------------------------------M
A0A0A1EUE4_E1B19K-01      MGSE-------S---------------------------------TSALM
A0A2H5AI21_E1B19K-01      -------------------------------------------------M
A0A2H5AI40_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AI99_E1B19K-01      -------------------------------------------------M
A0A2H5AID8_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A0M3TH18_E1B19K-01      -MKR-------P---------------------------VA----AEVQM
A0A2H4CJZ0_E1B19K-01      -------------------------------------------------M
H8PFZ1_E1B19K-01          -------------------------------------------------M
A0A0M3TH31_E1B19K-01      -------------------------------------------------M
Q6QPF3_E1B19K-01          -------------------------------------------------M
A0A9W3HRK4_E1B19K-01      -------------------------------------------------M
F2WTJ7_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAAV---GLG-----HFTM
A0A9W3INM3_E1B19K-01      -------------------------------------------------M
H9AA76_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGVVV---RLG-----HFTM
H9AAD9_E1B19K-01          -------------------------------------------------M
H9AAH3_E1B19K-01          -------------------------------------------------M
H9AAK5_E1B19K-01          MINGCELWLFIQRG---LPGRYKGS---GFQ-----ARGIYP---LAAFM
H9AAN8_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAVV---RLG-----HFTM
M9YVA3_E1B19K-01          -------------------------------------------------M
Q6QPI9_E1B19K-01          -------------------------------------------------M
Q8B6X5_E1B19K-01          -------------------------------------------------M
B5SNR1_E1B19K-01          -------------------------------------------------M
A0A1L7NRH1_E1B19K-01      -------------------------------------------------M
Q5UW22_E1B19K-01          -------------------------------------------------M
J7H4R9_E1B19K-01          -------------------------------------------------M
D2DM83_E1B19K-01          -------------------------------------------------M
A0A7U3S224_E1B19K-01      -------------------------------------------------M
J7I6W7_E1B19K-01          -------------------------------------------------M
J7I6W7_E1B19K-02          -------------------------------------------------M
M0QUB4_E1B19K-01          -------------------------------------------------M
C4P207_E1B19K-01          -------------------------------------------------M
D4N3H6_E1B19K-01          -------------------------------------------------M
M0QVK6_E1B19K-01          -------------------------------------------------M
M0QVT4_E1B19K-01          -------------------------------------------------M
A0A3G8WIY5_E1B19K-01      -------------------------------------------------M
T1ULP4_E1B19K-01          -------------------------------------------------M
A0A7R6T9I9_E1B19K-01      -------------------------------------------------M
B6C6W8_E1B19K-01          -------------------------------------------------M
B9A681_E1B19K-01          -------------------------------------------------M
A0A1Y1BYF1_E1B19K-01      -------------------------------------------------M
T1UHZ2_E1B19K-01          -------------------------------------------------M
M0QU41_E1B19K-02          -------------------------------------------------M
A0A075IQ70_E1B19K-01      -------------------------------------------------M
A0A075IQ70_E1B19K-02      -------------------------------------------------M
K7NG43_E1B19K-01          -------------------------------------------------M
Q2KRU2_E1B19K-01          -------------------------------------------------M
T1UIP3_E1B19K-01          -------------------------------------------------M
A0A3S6PYX7_E1B19K-02      -------------------------------------------------M
G1FC01_E1B19K-01          -------------------------------------------------M
E5RWL1_E1B19K-01          -------------------------------------------------M
M0QU41_E1B19K-01          -------------------------------------------------M
B2VQE3_E1B19K-01          -------------------------------------------------M
B6DU90_E1B19K-01          -------------------------------------------------M
M0QUN2_E1B19K-01          -------------------------------------------------M
E1CIM6_E1B19K-01          -------------------------------------------------M
E1AI10_E1B19K-01          -------------------------------------------------M
H0PPE7_E1B19K-01          -------------------------------------------------M
Q9YL99_E1B19K-01          -------------------------------------------------M
K7ZLN6_E1B19K-01          -------------------------------------------------M
E1CIR1_E1B19K-01          -------------------------------------------------M
E1AI10_E1B19K-02          -------------------------------------------------M
A0A384ZUF2_E1B19K-02      -------------------------------------------------M
R4HLA0_E1B19K-01          -------------------------------------------------M
Q2KSL3_E1B19K-01          -------------------------------------------------M
A0A5J6CTQ0_E1B19K-01      -------------------------------------------------M
I6LES1_E1B19K-01          -------------------------------------------------M
Q2KSL3_E1B19K-02          -------------------------------------------------M
I6LEP5_E1B19K-02          -------------------------------------------------M
I6LES1_E1B19K-02          -------------------------------------------------M
T1UF50_E1B19K-02          -------------------------------------------------M
M0QV08_E1B19K-01          -------------------------------------------------M
G9JUV5_E1B19K-01          -------------------------------------------------M
M0QV08_E1B19K-02          -------------------------------------------------M
T1UFS4_E1B19K-01          -------------------------------------------------M
T1UFS4_E1B19K-02          -------------------------------------------------M
X4YVU5_E1B19K-01          -------------------------------------------------M
E1CIJ0_E1B19K-01          -------------------------------------------------M
T1UGU0_E1B19K-01          -------------------------------------------------M
Q2KSM8_E1B19K-02          -------------------------------------------------M
A0A2R3WNP3_E1B19K-01      -------------------------------------------------M
Q2KSG6_E1B19K-01          -------------------------------------------------M
Q5GFC7_E1B19K-01          -------------------------------------------------M
Q5GFC8_E1B19K-01          -------------------------------------------------M
Q6H1D7_E1B19K-01          -------------------------------------------------M
T1UGY3_E1B19K-01          -------------------------------------------------M
A0A7U3S1T6_E1B19K-01      -------------------------------------------------M
J7ID56_E1B19K-02          -------------------------------------------------M
T1UKP8_E1B19K-01          -------------------------------------------------M
A0A075TSZ1_E1B19K-02      -------------------------------------------------M
A0A897JQR0_E1B19K-01      -------------------------------------------------M
I1V161_E1B19K-01          -------------------------------------------------M
A0A5P8KYF0_E1B19K-01      -------------------------------------------------M
J7I6S4_E1B19K-01          -------------------------------------------------M
A0A897JQR0_E1B19K-02      -------------------------------------------------M
I1V161_E1B19K-02          -------------------------------------------------M
A0A5P8KYF0_E1B19K-02      -------------------------------------------------M
J7I6S4_E1B19K-02          -------------------------------------------------M
T1UEX7_E1B19K-01          -------------------------------------------------M
T1UE63_E1B19K-01          -------------------------------------------------M
Q6RK98_E1B19K-01          -------------------------------------------------M
J7I6Q4_E1B19K-01          -------------------------------------------------M
J7I6Q4_E1B19K-02          -------------------------------------------------M
A0A4P2SGW2_E1B19K-01      -------------------------------------------------M
E1ARN8_E1B19K-01          -------------------------------------------------M
A0A6M5E4Y6_E1B19K-01      -------------------------------------------------M
P03247_E1B19K-01          -------------------------------------------------M
A0A3G8W3H5_E1B19K-01      -------------------------------------------------M
E1U5L6_E1B19K-01          -------------------------------------------------M
A0A516UYI9_E1B19K-01      -------------------------------------------------M
J9Z5H0_E1B19K-01          -------------------------------------------------M
Q6VGV8_E1B19K-01          -------------------------------------------------M
A0A0G2R248_E1B19K-01      -------------------------------------------------M
A0A0G2R248_E1B19K-02      -------------------------------------------------M
J9Z5H0_E1B19K-02          -------------------------------------------------M
A0A1P7YXN8_E1B19K-02      -------------------------------------------------M
A0A1P8C849_E1B19K-02      -------------------------------------------------M
T1UG22_E1B19K-01          -------------------------------------------------M
A0A2L1F392_E1B19K-01      -------------------------------------------------M
A0A2R3WN16_E1B19K-01      -------------------------------------------------M
A0A2R3WN62_E1B19K-01      -------------------------------------------------M
Q6H1D7_E1B19K-02          -------------------------------------------------M
A0A6M6AEV2_E1B19K-01      -------------------------------------------------M
A0A6M6AES6_E1B19K-01      -------------------------------------------------M
A0A9X9P8C6_E1B19K-01      -------------------------------------------------M
A0A6B9DS29_E1B19K-01      -------------------------------------------------M
W0S1G8_E1B19K-01          -------------------------------------------------M
J9Z4H6_E1B19K-01          -------------------------------------------------M
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      -------------------------------------------------M
A0A2H5AI72_E1B19K-01      -------------------------------------------------M
A0A2H5AIL3_E1B19K-01      -------------------------------------------------M
A0A0M5L3Y4_E1B19K-01      -------------------------------------------------M
Q5C8R2_E1B19K-01          -------------------------------------------------M
A0A2H5AII9_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AIN5_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AIU0_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AIL0_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AIS9_E1B19K-01      MGSE-------S---------------------------------TAALM
A0A2H5AIT6_E1B19K-01      MGSE-------S---------------------------------TAALM
M9YXY5_E1B19K-01          -------------------------------------------------M
H9AAS0_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAVV---RLG-----HFTM
H9AAV3_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAVV---RLG-----HFTM
H9AAY5_E1B19K-01          MIND-------VNFVCLF----KGDYLGGIKGAVV---RLG-----HFTM
                                                                            

Q7T8D8_E1B19K-03          SGN-ASFKGGVFSPYLTGRL------------------------------
Q6RK98_E1B19K-03          SGS-ASFEGGVFSPYLTGRL------------------------------
P04492_E1B19K-02          ERE-IPPELGLHAGLHVNAAVEGM---------------AEEEGLHLLAG
Q2KSM8_E1B19K-01          EIW-TVL-------------------------------------------
M9YVF6_E1B19K-01          DLL-RLL-------------------------------------------
T2CI10_E1B19K-01          EVW-AIL-------------------------------------------
A0A1W5PVU4_E1B19K-01      ELD-RLL-------------------------------------------
A0A3Q9HK00_E1B19K-01      EAW-ECL-------------------------------------------
A0A9X9PKC1_E1B19K-01      EFW-SEL-------------------------------------------
A0A5K6WAR5_E1B19K-01      EAW-ECL-------------------------------------------
T2CI10_E1B19K-02          DPT-DPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
A0A2H5AIC5_E1B19K-01      DLL-GNL-------------------------------------------
A0A0M4N3Z1_E1B19K-01      DLR-TAL-------------------------------------------
A0A3S9SPV1_E1B19K-01      EAW-ECL-------------------------------------------
A0A9W3HRK4_E1B19K-02      ERA-DAAQPGLYSGLPDAMPMEVRNQ-------------EGEEAVRALGG
A0A7L4WJT1_E1B19K-01      EAW-ECL-------------------------------------------
D3JIR7_E1B19K-02          EPD-VPAELGLHAGLHGNAAVEGM---------------AHEEGLHLLAG
Q2KSM8_E1B19K-03          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
A0A7U3RVU4_E1B19K-01      ELW-SEL-------------------------------------------
F2WTM9_E1B19K-01          NLR-VEL-------------------------------------------
A0A0M4NHE0_E1B19K-01      DLR-AEL-------------------------------------------
A0A2H4PJ75_E1B19K-01      EAW-ECL-------------------------------------------
G0ZAH2_E1B19K-01          DLL-KFL-------------------------------------------
P10406_E1B19K-01          EIW-TVL-------------------------------------------
M0QU02_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
J9Z4H6_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
P04492_E1B19K-01          ELE-TVL-------------------------------------------
A0A898KBW7_E1B19K-01      EFW-SEL-------------------------------------------
A0A7L4WG90_E1B19K-01      EAW-ECL-------------------------------------------
A0A3S9SND6_E1B19K-01      EAW-ECL-------------------------------------------
J7I6T8_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
A0A5H2QAX5_E1B19K-01      ELE-AVL-------------------------------------------
Q6QPB7_E1B19K-01          EIW-TVL-------------------------------------------
A0A8G1GLF6_E1B19K-01      EFW-SEL-------------------------------------------
T1UG63_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
A0A3Q9HJ63_E1B19K-01      EAW-ECL-------------------------------------------
T1UEX7_E1B19K-02          ERE-VPPELGLHAGLHGNAFVEGM---------------AEEEGLHLLAG
F6KST6_E1B19K-01          DLY-ESL-------------------------------------------
A0A482EVC6_E1B19K-02      ERP-NPSVGGVYSGLHDNGPVENPA--------------AEEEGLRLLAG
A0A3Q9HK78_E1B19K-01      EAW-ECL-------------------------------------------
H9AAA8_E1B19K-01          DLR-VEL-------------------------------------------
A0MK43_E1B19K-02          EQQRQPPVVGVHAGLHGDGSVEGH---------------AAEEGLHLLAG
Q32UI6_E1B19K-02          DPA-DSFQQGIRFGFRSHSIVENMEG------------SQDEDNLRLLAS
A0A3S6PYX7_E1B19K-01      DVW-TIL-------------------------------------------
Q5GFC7_E1B19K-03          ESR-NPFQQGLPAGFLSSSFVENMEV------------PAPECNLRLLAG
A0A3Q9HJ54_E1B19K-01      EAW-ECL-------------------------------------------
A0A898KBR0_E1B19K-01      EFW-SEL-------------------------------------------
J9Z4N4_E1B19K-01          EAW-ECL-------------------------------------------
P10544_E1B19K-01          EFW-SEL-------------------------------------------
F4ZCJ8_E1B19K-01          EFW-SEL-------------------------------------------
Q8UY91_E1B19K-01          EIW-TVL-------------------------------------------
A0A9W3I4N3_E1B19K-01      DLY-ESL-------------------------------------------
A0A1L3INW0_E1B19K-01      DLY-KSL-------------------------------------------
A0A097IW62_E1B19K-01      DLD-RVL-------------------------------------------
A0A3G4W995_E1B19K-01      EFW-SEL-------------------------------------------
A0A7D0TLU2_E1B19K-01      EAW-ECL-------------------------------------------
G9G841_E1B19K-01          EIW-TIL-------------------------------------------
Q6VGV8_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGCE------------TQESPATVVFRP
P06501_E1B19K-01          DLR-TAL-------------------------------------------
Q71BY5_E1B19K-01          RHI--ICHGGVITEEMAASLLDQLIE------------EVLADNLPP--P
Q71BY5_E1B19K-03          RHI--ICHGGVITEEMAASLLDQLIE------------EVLCLNLSL-SP
Q5GFC7_E1B19K-05          ESR-NPFQQGLPAGFLSSSFVENMEV------------PAPECNLRLLAG
E1ARN8_E1B19K-03          ERR-NPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAA
Q2KSG6_E1B19K-05          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
Q2KSM8_E1B19K-05          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
Q2KSM8_E1B19K-04          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
Q5GFC7_E1B19K-04          ESR-NPFQQGLPAGFLSSSFVENMEV------------PAPECNLRLLAG
E1ARN8_E1B19K-04          ERR-NPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTDGGAAAA
E1U5L6_E1B19K-04          ERR-NPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAT--
A0A1C8EG46_E1B19K-01      DLR-VEL-------------------------------------------
W6EIX6_E1B19K-01          EVW-AIL-------------------------------------------
W6EIX6_E1B19K-02          DPA-DSFQQGIRFGFHSHSIVENMEG------------SQDEDNLRLLAS
Q7T8D8_E1B19K-01          EVW-AIL-------------------------------------------
Q7T8D8_E1B19K-02          DPA-DSFQQGIRFGFHSHSIVENMEG------------SQDEDNLRLLAS
Q8B8U7_E1B19K-01          EVW-AIL-------------------------------------------
Q32UI6_E1B19K-01          EVW-AIL-------------------------------------------
B9A5Q1_E1B19K-01          DVW-TIL-------------------------------------------
B9A5T7_E1B19K-01          DVW-TIL-------------------------------------------
M0QU76_E1B19K-01          DVW-TIL-------------------------------------------
M0QU76_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGE------------AAGTENLELLAY
A0A0B4SJH1_E1B19K-01      EVW-AIL-------------------------------------------
A0A0B4SJH1_E1B19K-02      DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
Q2KS85_E1B19K-01          EVW-AIL-------------------------------------------
Q2KS85_E1B19K-02          DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
C5HDR2_E1B19K-01          DVW-TIL-------------------------------------------
C5HDR2_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGQ------------AAGTENLELLAY
D3GBW3_E1B19K-01          DVW-TIL-------------------------------------------
M0QUB4_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
W8CZB0_E1B19K-01          EVW-TIL-------------------------------------------
W8CZB0_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGLGQ------------AAGTENLELLAS
M0QUF3_E1B19K-01          DVW-TIL-------------------------------------------
M0QUF3_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGE------------AAGTENLELLAY
M0QUJ3_E1B19K-01          DVW-TIL-------------------------------------------
M0QUJ3_E1B19K-02          EPG-HPTEQGIHPGLRSHAPVEGLDQ------------AAGTENLELLAS
M0QUN2_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
C4P207_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
R4HLJ6_E1B19K-01          EVW-AIL-------------------------------------------
R4HLJ6_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
M0QTS5_E1B19K-01          EVW-TIL-------------------------------------------
M0QTS5_E1B19K-02          EPE-HPTEQGLHSGLRGHAPVEGLGQ------------AAGTENLELLAS
M0QUS9_E1B19K-01          EVW-TIL-------------------------------------------
M0QUS9_E1B19K-02          EPG-HPTEQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
Q3ZL02_E1B19K-01          EVW-AIL-------------------------------------------
Q3ZL02_E1B19K-02          DPA-DSFQQGIRFGFRSHSIVENMEG------------SQDEDNLRLLAS
M0QV47_E1B19K-01          EVW-TIL-------------------------------------------
M0QV47_E1B19K-02          EPA-NPPNQGLHPGLHGHASVEGLGQ------------AAGTENLELLAS
M0QV87_E1B19K-01          DVW-TIL-------------------------------------------
M0QV87_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
M0QVC7_E1B19K-01          DVW-TIL-------------------------------------------
M0QVC7_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGE------------AAGTENLELLAY
M0QVG6_E1B19K-01          EVW-TIL-------------------------------------------
M0QVG6_E1B19K-02          EPA-NPSDQGLHPGLHGHASVEGLGQ------------AAGTENLELLAS
M0QVK6_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
M0QVP5_E1B19K-01          DVW-TIL-------------------------------------------
M0QVP5_E1B19K-02          EPA-NPPNQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
Q4KSL0_E1B19K-01          DVW-TIL-------------------------------------------
M0QUW8_E1B19K-01          EVW-TIL-------------------------------------------
M0QUW8_E1B19K-02          EPA-NPPNQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
A0A3G9JTX5_E1B19K-01      EIW-TVL-------------------------------------------
A0A3G9K5X3_E1B19K-01      EIW-TVL-------------------------------------------
A0A3G9CMQ4_E1B19K-01      EIW-TVL-------------------------------------------
Q3ZKW2_E1B19K-01          EVW-AIL-------------------------------------------
Q3ZKW2_E1B19K-02          DPT-NPLQQGIRFGFHSSSFVENMEG------------SQHEDNLRLLAS
M0QVT4_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
A0MK43_E1B19K-01          DLL-GNL-------------------------------------------
A0A3Q9FFS0_E1B19K-01      DVW-SIL-------------------------------------------
A0A3Q9FFS0_E1B19K-02      EPE-HPTEQGLHSGLCSHAPVEGMGE------------AAGTENLELLAY
E5RWD9_E1B19K-01          DVW-TIL-------------------------------------------
B9A5L5_E1B19K-01          DVW-SIL-------------------------------------------
A0A7G5F9T0_E1B19K-01      EVW-AIL-------------------------------------------
A0A7G5FB98_E1B19K-01      EVW-AIL-------------------------------------------
A0A7G5FB98_E1B19K-02      DPA-DSFQQGIRFGFRSHSIVENMEG------------SQDEDNLRLLAS
C7SRS7_E1B19K-01          EVW-AIL-------------------------------------------
A0A1Y1BXT7_E1B19K-01      DVW-TIL-------------------------------------------
E9P585_E1B19K-01          DVW-TIL-------------------------------------------
E9P585_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
G1FC01_E1B19K-02          EPE-HPTEQGLHSGLRGHAPVEGLGQ------------AAGTENLELLAS
G1DE13_E1B19K-01          ELE-AVL-------------------------------------------
G1FBW4_E1B19K-01          EVW-TIL-------------------------------------------
G1FBW4_E1B19K-02          EPA-NPPNQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
R4HLA0_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
H5T740_E1B19K-01          EVW-TIL-------------------------------------------
K7NG43_E1B19K-02          DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
T1UHL7_E1B19K-01          DVW-TIL-------------------------------------------
T1UHL7_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEVLDQ------------AAGTENLELLAS
R4HMC6_E1B19K-01          EVW-AIL-------------------------------------------
R4HMC6_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLKLLAS
W8VNG2_E1B19K-01          EVW-TIL-------------------------------------------
A0A3G8WH01_E1B19K-01      ELE-TVL-------------------------------------------
D3JIR7_E1B19K-01          ELE-AVL-------------------------------------------
A0A5H2QAX5_E1B19K-02      ERE-VPPELGLHAGLHDNAFVEGM---------------AEEEGLHLLAG
D0Z5R9_E1B19K-01          ELE-AVL-------------------------------------------
Q2KRU2_E1B19K-02          DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
R4HLE1_E1B19K-01          EVW-AIL-------------------------------------------
R4HLE1_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
Q7T951_E1B19K-01          EVW-AIL-------------------------------------------
A0A8B0L9Y2_E1B19K-01      EVW-AIL-------------------------------------------
A0A8B0LBX6_E1B19K-01      EVW-AIL-------------------------------------------
A0A8B0LCV0_E1B19K-01      EVW-AIL-------------------------------------------
A0A8B0LD36_E1B19K-01      EVW-AIL-------------------------------------------
Q2Y0J3_E1B19K-01          EVW-AIL-------------------------------------------
Q2Y0J3_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
A0A220VZ73_E1B19K-01      EVW-AIL-------------------------------------------
P03248_E1B19K-03          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
P03248_E1B19K-02          EVW-AIL-------------------------------------------
Q5EY83_E1B19K-01          EVW-AIL-------------------------------------------
Q5EY83_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
A0A7D6TSN5_E1B19K-01      EAW-ECL-------------------------------------------
Q71BY5_E1B19K-02          RHI--ICHGGVITEEMAASLLDQLIE------------EVLADNLPP--P
Q71BY5_E1B19K-04          EAW-ECL-------------------------------------------
A0A1U9ALK7_E1B19K-01      EAW-ECL-------------------------------------------
A0A4P2SGW2_E1B19K-02      ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
P03246_E1B19K-01          EAW-ECL-------------------------------------------
Q6WQ37_E1B19K-01          EAW-ECL-------------------------------------------
E1U5L6_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
E1U5L6_E1B19K-03          ERR-NPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGAT--
F1DT57_E1B19K-01          DVW-TIL-------------------------------------------
F1DT57_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGQ------------AAGTENLELLAS
A0A1P7YWR9_E1B19K-01      DVW-SIL-------------------------------------------
A0A1P7YWR9_E1B19K-02      EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
A0A1P7YWY2_E1B19K-02      EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
A0A1P7YWY2_E1B19K-01      DVW-SIL-------------------------------------------
A0A1P7YXN8_E1B19K-01      DVW-SIL-------------------------------------------
A0A1P7YYY5_E1B19K-02      EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
A0A1P7YYY5_E1B19K-01      DVW-SIL-------------------------------------------
A0A1P8C849_E1B19K-01      DVW-SIL-------------------------------------------
B9A5A7_E1B19K-01          DVW-SIL-------------------------------------------
M0QU02_E1B19K-01          DVW-TIL-------------------------------------------
A0A3G8W6L2_E1B19K-01      EIW-TVL-------------------------------------------
Q2KSG6_E1B19K-02          EIW-TVL-------------------------------------------
Q2KSG6_E1B19K-04          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
Q2KSG6_E1B19K-03          ESR-NPFQQGLPVGFLSSSFVESMEV------------PAPECNLRLLAG
Q5GFC7_E1B19K-02          EIW-TVL-------------------------------------------
A0A142G3J2_E1B19K-01      ELW-SEL-------------------------------------------
P10543_E1B19K-01          ELW-SEL-------------------------------------------
A0A1S6ELT2_E1B19K-01      EFW-SEL-------------------------------------------
A0A3G8W407_E1B19K-01      EFW-SEL-------------------------------------------
A0A482EVC6_E1B19K-01      EFW-SEL-------------------------------------------
A0A7U3RWV6_E1B19K-01      EFW-SEL-------------------------------------------
A0A898KBS1_E1B19K-01      EFW-SEL-------------------------------------------
A0A513TZR1_E1B19K-01      EAW-ECL-------------------------------------------
A0A516UYM9_E1B19K-01      EAW-ECL-------------------------------------------
A0A0K0PX35_E1B19K-01      EVW-AIL-------------------------------------------
A0A0K0PX99_E1B19K-01      EVW-AIL-------------------------------------------
A0A6M6AA96_E1B19K-01      EVW-AIL-------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          EVW-AIL-------------------------------------------
J7ID56_E1B19K-01          EVW-AIL-------------------------------------------
T1UE63_E1B19K-02          DPA-DSFQQGIRFGFHSHSIVENMEG------------SQDEDNLRLLAS
T1UF50_E1B19K-01          KVW-AIL-------------------------------------------
T1UIP3_E1B19K-02          DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
T1UJX4_E1B19K-01          EVW-AIL-------------------------------------------
T1UJX4_E1B19K-02          DPA-DSFQQGIRFGFHSHSIVENMEG------------SQDEDNLRLLAS
A0A291P1B2_E1B19K-01      ETW-ECL-------------------------------------------
A0A3Q9HJZ5_E1B19K-01      EAW-ECL-------------------------------------------
A0A3Q9HLF7_E1B19K-01      EAW-ECL-------------------------------------------
A0A3S9SNH4_E1B19K-01      EAW-ECL-------------------------------------------
A0A3S9SNY0_E1B19K-01      EAW-ECL-------------------------------------------
A0A3S9SP19_E1B19K-01      EAW-ECL-------------------------------------------
A0A3S9SSS2_E1B19K-01      EAW-ECL-------------------------------------------
A0A6M4W5T4_E1B19K-01      EAW-ECL-------------------------------------------
A0A7D0TN91_E1B19K-01      EAW-ECL-------------------------------------------
A0A7L4WGT1_E1B19K-01      EAW-ECL-------------------------------------------
A0A7L4WIC2_E1B19K-01      EAW-ECL-------------------------------------------
A0A7L4WIG2_E1B19K-01      EAW-ECL-------------------------------------------
A0A7L4WK62_E1B19K-01      EAW-ECL-------------------------------------------
A0A8F9W8V2_E1B19K-01      EAW-ECL-------------------------------------------
E1ARN8_E1B19K-02          ERR-NPSERGVPAGFSGHAFVESGGE------------TQESPTTVVFRP
J7I6T8_E1B19K-01          EAW-ECL-------------------------------------------
J9Z4N4_E1B19K-02          ERR-NPSERGVPAGFSGHAFVESSGE------------TQESPATVVFRP
T1UG63_E1B19K-01          EAW-ECL-------------------------------------------
A0A075TSZ1_E1B19K-01      DVW-TIL-------------------------------------------
A0A097I4T0_E1B19K-01      DVW-TIL-------------------------------------------
A0A097I4T0_E1B19K-02      EPE-HPTEQGLHSGLRSHAPVEGMGQ------------AAGTENLELLAY
A0A0G2UY10_E1B19K-01      DVW-TIL-------------------------------------------
A0A0G2UY10_E1B19K-02      EPE-HPTEQGLHSGLRGHAPVEVLDQ------------AAGTENLELLAS
A0A1J0MS84_E1B19K-01      DVW-TIL-------------------------------------------
A0A291B0H2_E1B19K-01      DVW-TIL-------------------------------------------
A0A384ZUF2_E1B19K-01      DVW-TIL-------------------------------------------
A0A384ZUM9_E1B19K-01      DVW-TIL-------------------------------------------
A0A384ZUM9_E1B19K-02      EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
F8UFP5_E1B19K-02          EPE-HPTEQGLHPGLRGHAPVEGLDQ------------AAGTENLELLAS
F8UFP5_E1B19K-01          EVW-TIL-------------------------------------------
G3CK71_E1B19K-02          EPE-HPTEQGLHSGLRGHAPVEGLGQ------------AAGTENLELLAS
G3CK71_E1B19K-01          EVW-TIL-------------------------------------------
T1UG22_E1B19K-02          EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
T1UGT5_E1B19K-02          EPE-HPTEQGLHPGLRGHAPVEGLGQ------------AAGTENLELLAS
T1UGT5_E1B19K-01          EVW-TIL-------------------------------------------
T1UGU0_E1B19K-02          EPA-NPPNQGLHPGLHGHASVEGLGQ------------AAGTENLELLAS
T1UGX3_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGLGQ------------AAGTENLELLAS
T1UGX3_E1B19K-01          DVW-TIL-------------------------------------------
T1UGY3_E1B19K-02          EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
T1UHG3_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
T1UHG3_E1B19K-01          DVW-TIL-------------------------------------------
T1UHH6_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEVLDQ------------AAGTENLELLAS
T1UHH6_E1B19K-01          DVW-TIL-------------------------------------------
T1UHQ8_E1B19K-01          DVW-TIL-------------------------------------------
T1UHQ8_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
T1UHZ2_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGE------------AAGTENLELLAY
T1UK99_E1B19K-01          EVW-TIL-------------------------------------------
T1UK99_E1B19K-02          EPA-NPLNQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
T1UKP8_E1B19K-02          EPG-HPTEQGIHPGLRSHAPVEVLDQ------------AAGTENLELLAS
T1UKQ0_E1B19K-02          EPA-NPLNQGLHPGLHGHAPVEGLGQ------------AAGTENLELLAS
T1UKQ0_E1B19K-01          DVW-TIL-------------------------------------------
T1UKV6_E1B19K-01          DVW-TIL-------------------------------------------
T1UKV6_E1B19K-02          EPG-HPTEQGLHPGLRSHASVEGLDQ------------AAGTENLELLAS
T1ULJ8_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
T1ULJ8_E1B19K-01          DVW-TIL-------------------------------------------
T1ULP4_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
X4Y9D2_E1B19K-01          DVW-TIL-------------------------------------------
A0A0A1EUB2_E1B19K-01      DLL-GDL-------------------------------------------
A0A0A1EUC8_E1B19K-01      DLL-GDL-------------------------------------------
A0A0A1EUE4_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AI21_E1B19K-01      DLL-GDL-------------------------------------------
A0A2H5AI40_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AI99_E1B19K-01      DLL-KEL-------------------------------------------
A0A2H5AID8_E1B19K-01      DLL-GNL-------------------------------------------
A0A0M3TH18_E1B19K-01      ELD-RLL-------------------------------------------
A0A2H4CJZ0_E1B19K-01      EFW-SEL-------------------------------------------
H8PFZ1_E1B19K-01          EYW-SEL-------------------------------------------
A0A0M3TH31_E1B19K-01      DLL-RLL-------------------------------------------
Q6QPF3_E1B19K-01          EIW-TVL-------------------------------------------
A0A9W3HRK4_E1B19K-01      DLY-ESL-------------------------------------------
F2WTJ7_E1B19K-01          DLR-VEL-------------------------------------------
A0A9W3INM3_E1B19K-01      DLY-ESL-------------------------------------------
H9AA76_E1B19K-01          DLR-VEL-------------------------------------------
H9AAD9_E1B19K-01          DLR-AEL-------------------------------------------
H9AAH3_E1B19K-01          DLR-AEL-------------------------------------------
H9AAK5_E1B19K-01          DLR-AEL-------------------------------------------
H9AAN8_E1B19K-01          DLR-VEL-------------------------------------------
M9YVA3_E1B19K-01          DLR-VEL-------------------------------------------
Q6QPI9_E1B19K-01          EIW-TVL-------------------------------------------
Q8B6X5_E1B19K-01          DLR-TAL-------------------------------------------
B5SNR1_E1B19K-01          EFW-SEL-------------------------------------------
A0A1L7NRH1_E1B19K-01      EVW-AIL-------------------------------------------
Q5UW22_E1B19K-01          EVW-AIL-------------------------------------------
J7H4R9_E1B19K-01          EVW-AIL-------------------------------------------
D2DM83_E1B19K-01          EVW-AIL-------------------------------------------
A0A7U3S224_E1B19K-01      EVW-AIL-------------------------------------------
J7I6W7_E1B19K-01          EVW-AIL-------------------------------------------
J7I6W7_E1B19K-02          DPA-DSFQQGIRFGFRSHSIVENMEG------------SQDEDNLRLLAS
M0QUB4_E1B19K-01          DVW-TIL-------------------------------------------
C4P207_E1B19K-01          DVW-TIL-------------------------------------------
D4N3H6_E1B19K-01          DVW-TIL-------------------------------------------
M0QVK6_E1B19K-01          DVW-TIL-------------------------------------------
M0QVT4_E1B19K-01          DVW-TIL-------------------------------------------
A0A3G8WIY5_E1B19K-01      DVW-TIL-------------------------------------------
T1ULP4_E1B19K-01          DVW-TIL-------------------------------------------
A0A7R6T9I9_E1B19K-01      DVW-TIL-------------------------------------------
B6C6W8_E1B19K-01          DVW-TIL-------------------------------------------
B9A681_E1B19K-01          DVW-TIL-------------------------------------------
A0A1Y1BYF1_E1B19K-01      DVW-TIL-------------------------------------------
T1UHZ2_E1B19K-01          DVW-TIL-------------------------------------------
M0QU41_E1B19K-02          EPE-HPTEQGLHSGLRSHAPVEGMGE------------AAGTENLELLAY
A0A075IQ70_E1B19K-01      EVW-AIL-------------------------------------------
A0A075IQ70_E1B19K-02      DPP-NPLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
K7NG43_E1B19K-01          EVW-AIL-------------------------------------------
Q2KRU2_E1B19K-01          EVW-AIL-------------------------------------------
T1UIP3_E1B19K-01          EVW-AIL-------------------------------------------
A0A3S6PYX7_E1B19K-02      EPE-HPTEQGLHSGLRSHAPVEGMGQ------------AAGTENLELLAY
G1FC01_E1B19K-01          EVW-TIL-------------------------------------------
E5RWL1_E1B19K-01          DVW-TIL-------------------------------------------
M0QU41_E1B19K-01          DVW-TIL-------------------------------------------
B2VQE3_E1B19K-01          DVW-TIL-------------------------------------------
B6DU90_E1B19K-01          DVW-TIL-------------------------------------------
M0QUN2_E1B19K-01          DVW-TIL-------------------------------------------
E1CIM6_E1B19K-01          DVW-TIL-------------------------------------------
E1AI10_E1B19K-01          DVW-TIL-------------------------------------------
H0PPE7_E1B19K-01          DVW-TIL-------------------------------------------
Q9YL99_E1B19K-01          DVW-TIL-------------------------------------------
K7ZLN6_E1B19K-01          DVW-TIL-------------------------------------------
E1CIR1_E1B19K-01          DVW-TIL-------------------------------------------
E1AI10_E1B19K-02          EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
A0A384ZUF2_E1B19K-02      EPG-HPTEQGLHPGLRSHAPVEGLDQ------------AAGTENLELLAS
R4HLA0_E1B19K-01          EVW-AIL-------------------------------------------
Q2KSL3_E1B19K-01          EVW-AIL-------------------------------------------
A0A5J6CTQ0_E1B19K-01      EVW-AIL-------------------------------------------
I6LES1_E1B19K-01          EVW-AIL-------------------------------------------
Q2KSL3_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
I6LEP5_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
I6LES1_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
T1UF50_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
M0QV08_E1B19K-01          EVW-TIL-------------------------------------------
G9JUV5_E1B19K-01          EVW-TIL-------------------------------------------
M0QV08_E1B19K-02          EPE-HPTEQGLHSGLRGHAPVEGLGQ------------AAGTENLELLAS
T1UFS4_E1B19K-01          EVW-AIL-------------------------------------------
T1UFS4_E1B19K-02          DPA-DSFQQGIRFGFRSHSIVENMEG------------SQDEDNLRLLAS
X4YVU5_E1B19K-01          EVW-TIL-------------------------------------------
E1CIJ0_E1B19K-01          EVW-TIL-------------------------------------------
T1UGU0_E1B19K-01          EVW-TIL-------------------------------------------
Q2KSM8_E1B19K-02          EIW-TVL-------------------------------------------
A0A2R3WNP3_E1B19K-01      EIW-TVL-------------------------------------------
Q2KSG6_E1B19K-01          EIW-TVL-------------------------------------------
Q5GFC7_E1B19K-01          EIW-TVL-------------------------------------------
Q5GFC8_E1B19K-01          EIW-TVL-------------------------------------------
Q6H1D7_E1B19K-01          EIW-TVL-------------------------------------------
T1UGY3_E1B19K-01          DVW-SIL-------------------------------------------
A0A7U3S1T6_E1B19K-01      EVW-AIL-------------------------------------------
J7ID56_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
T1UKP8_E1B19K-01          DVW-TIL-------------------------------------------
A0A075TSZ1_E1B19K-02      EPG-HPTEQGLHPGLRSHAPVEVLDQ------------AAGTENLELLAS
A0A897JQR0_E1B19K-01      EVW-AIL-------------------------------------------
I1V161_E1B19K-01          EVW-AIL-------------------------------------------
A0A5P8KYF0_E1B19K-01      EVW-AIL-------------------------------------------
J7I6S4_E1B19K-01          EVW-AIL-------------------------------------------
A0A897JQR0_E1B19K-02      DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLKLLAS
I1V161_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLKLLAS
A0A5P8KYF0_E1B19K-02      DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLKLLAS
J7I6S4_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLKLLAS
T1UEX7_E1B19K-01          ELE-AVL-------------------------------------------
T1UE63_E1B19K-01          EVW-AIL-------------------------------------------
Q6RK98_E1B19K-01          EVW-AIL-------------------------------------------
J7I6Q4_E1B19K-01          EVW-AIL-------------------------------------------
J7I6Q4_E1B19K-02          DPP-NSLQQGIRFGFHSSSFVENMEG------------SQDEDNLRLLAS
A0A4P2SGW2_E1B19K-01      EAW-ECL-------------------------------------------
E1ARN8_E1B19K-01          EAW-ECL-------------------------------------------
A0A6M5E4Y6_E1B19K-01      EAW-ECL-------------------------------------------
P03247_E1B19K-01          EAW-ECL-------------------------------------------
A0A3G8W3H5_E1B19K-01      EAW-ECL-------------------------------------------
E1U5L6_E1B19K-01          EAW-ECL-------------------------------------------
A0A516UYI9_E1B19K-01      EAW-ECL-------------------------------------------
J9Z5H0_E1B19K-01          EAW-ECL-------------------------------------------
Q6VGV8_E1B19K-01          EAW-ECL-------------------------------------------
A0A0G2R248_E1B19K-01      EAW-ECL-------------------------------------------
A0A0G2R248_E1B19K-02      ERR-NPSERGVPAGFSGHASVESGCE------------TQESPATVVFRP
J9Z5H0_E1B19K-02          ERR-NPSERGVPAGFSGHASVESGGE------------TQESPATVVFRP
A0A1P7YXN8_E1B19K-02      EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
A0A1P8C849_E1B19K-02      EPG-HPTKQGLHSGLCSHAPVEGLDE------------AAGTENLELLAS
T1UG22_E1B19K-01          DVW-SIL-------------------------------------------
A0A2L1F392_E1B19K-01      EIW-TVL-------------------------------------------
A0A2R3WN16_E1B19K-01      EIW-TVL-------------------------------------------
A0A2R3WN62_E1B19K-01      EIW-TVL-------------------------------------------
Q6H1D7_E1B19K-02          ESR-NPFQQGLPAGFLSSSFVENMEV------------PAPECNLRLLAG
A0A6M6AEV2_E1B19K-01      ELW-SEL-------------------------------------------
A0A6M6AES6_E1B19K-01      EFW-SEL-------------------------------------------
A0A9X9P8C6_E1B19K-01      EFW-SEL-------------------------------------------
A0A6B9DS29_E1B19K-01      EFW-SEL-------------------------------------------
W0S1G8_E1B19K-01          EFW-SEL-------------------------------------------
J9Z4H6_E1B19K-01          EAW-ECL-------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      DLL-GDL-------------------------------------------
A0A2H5AI72_E1B19K-01      DLL-GDL-------------------------------------------
A0A2H5AIL3_E1B19K-01      DLL-GDL-------------------------------------------
A0A0M5L3Y4_E1B19K-01      DLL-GDL-------------------------------------------
Q5C8R2_E1B19K-01          DLL-GDL-------------------------------------------
A0A2H5AII9_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AIN5_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AIU0_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AIL0_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AIS9_E1B19K-01      DLL-GNL-------------------------------------------
A0A2H5AIT6_E1B19K-01      DLL-GNL-------------------------------------------
M9YXY5_E1B19K-01          DLL-RLL-------------------------------------------
H9AAS0_E1B19K-01          DLR-VEL-------------------------------------------
H9AAV3_E1B19K-01          DLR-VEL-------------------------------------------
H9AAY5_E1B19K-01          DLR-VEL-------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          AA------------------------------------FDHAAAADV--A
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          TA------------------------------------SGRSRDPET--P
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      EA------------------------------------SVSAPAASASSS
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          AA------------------------------------FDHAATANV---
Q2KSM8_E1B19K-03          TA------------------------------------ARHSEDPKS--P
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          TA------------------------------------SSSGSSSST--Q
J9Z4H6_E1B19K-02          PG------------------------------------NNTDGRAAA-AA
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          PG------------------------------------NNTDGGAA---A
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          PG------------------------------------NNTDGGAAA--A
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          AA------------------------------------SNHAAVA-----
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      AA------------------------------------SARSGS------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          AA------------------------------------SAAGPS------
Q32UI6_E1B19K-02          AA------------------------------------FGCSGNPEA--S
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          TA------------------------------------ARHSEDPES---
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          PG------------------------------------DNTDGGAA----
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          SHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLT--F
Q71BY5_E1B19K-03          SQ------------------------------------------------
Q5GFC7_E1B19K-05          TA------------------------------------ARHSEDPES--P
E1ARN8_E1B19K-03          TA------------------------------------AAGGS-------
Q2KSG6_E1B19K-05          TA------------------------------------ARHSEDPKS--P
Q2KSM8_E1B19K-05          TA------------------------------------ARHSEDPKS--P
Q2KSM8_E1B19K-04          TA------------------------------------ARHSEDPKS--P
Q5GFC7_E1B19K-04          TA------------------------------------ARHSEDPES--P
E1ARN8_E1B19K-04          TA------------------------------------AAGG--------
E1U5L6_E1B19K-04          ---------------------------------------AGG--------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          AA------------------------------------FGCSGNPEA--S
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          AA------------------------------------FGCSGNPEA--S
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      AA------------------------------------SGSSRDTET--P
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          AA------------------------------------SGSSRDTET--P
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          TA------------------------------------SSSGSSSST--Q
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          TA------------------------------------SSSGSSSST--Q
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QUN2_E1B19K-02          TA------------------------------------SSSGSSSST--Q
C4P207_E1B19K-02          TA------------------------------------SSSGSSSST--Q
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          AA------------------------------------SGSSRDTET--P
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          TA------------------------------------SSSGSSSST--Q
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          AA------------------------------------FGCSGNPEA--S
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QVK6_E1B19K-02          TA------------------------------------SSSGSSSST--Q
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          TA------------------------------------SSSGSSSST--Q
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          AA------------------------------------SGSSRDTET--P
M0QVT4_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      TA------------------------------------SSSGSSSST--Q
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      AA------------------------------------FGCSGNPEA--S
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          TA------------------------------------SSSGSSSST--Q
G1FC01_E1B19K-02          TA------------------------------------SSSGSSSST--Q
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          TA------------------------------------SSSGSSSST--Q
R4HLA0_E1B19K-02          AA------------------------------------SGSSRDTET--P
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          AA------------------------------------SGSSRDTET--P
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          TA------------------------------------SSSGSSSST--Q
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          AA------------------------------------SRSSRDTET--P
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      AA------------------------------------SNHAAVA-----
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          AA------------------------------------SGSSRDTET--P
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          AA------------------------------------SRSSRDIET--P
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          AA------------------------------------SGSSRDTET--P
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          AA------------------------------------SRSSRDTET--P
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          AA------------------------------------SGSSRDTET--P
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          AA------------------------------------SRSSRDTET--P
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          SHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLT--F
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      PG------------------------------------NNTDGGAAA--A
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          PG------------------------------------NNTDGG------
E1U5L6_E1B19K-03          ---------------------------------------AGGS-------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      TA------------------------------------SSFGSSSST--Q
A0A1P7YWY2_E1B19K-02      TA------------------------------------SSFGSSSST--Q
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      TA------------------------------------SSFGSSSST--Q
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          TA------------------------------------ARHSEDPKS--P
Q2KSG6_E1B19K-03          TA------------------------------------ARHSEDPKS--P
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          AA------------------------------------FGCSGNPEA--S
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          AA------------------------------------SGSSRDTET--P
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          AA------------------------------------FGCSGNPEA--S
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          PG------------------------------------NNTDGGAAA--A
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          PG------------------------------------NNTDGGAA---A
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      TA------------------------------------SSSGSSSST--Q
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      TA------------------------------------SSSGSSSST--Q
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      TA------------------------------------SSSGSSSST--Q
F8UFP5_E1B19K-02          TA------------------------------------SSSGSSSST--Q
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          TA------------------------------------SSSGSSSST--Q
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          TA------------------------------------SSFGSSSST--Q
T1UGT5_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UGX3_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          TA------------------------------------SSFGSSSST--Q
T1UHG3_E1B19K-02          TA------------------------------------SSSGSSLST--Q
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UHZ2_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UKP8_E1B19K-02          TA------------------------------------SSSRSSSST--Q
T1UKQ0_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1ULJ8_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          TA------------------------------------SSSGSSSST--Q
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          AA------------------------------------FGCSGNPEA--S
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      AA------------------------------------SGSSRDTET--P
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      TA------------------------------------SSSGSSSST--Q
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          TA------------------------------------SSSGSSSST--Q
A0A384ZUF2_E1B19K-02      TA------------------------------------SSSGSSSST--Q
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          AA------------------------------------SGSSRDTET--P
I6LEP5_E1B19K-02          AA------------------------------------SGSSRDTET--P
I6LES1_E1B19K-02          AA------------------------------------SGSSRDTET--P
T1UF50_E1B19K-02          AA------------------------------------SGSSRDTET--P
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          TA------------------------------------SSSGSSSST--Q
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          AA------------------------------------FGCSGNPEA--S
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          AA------------------------------------SGSSRDTET--P
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      TA------------------------------------SSSGSSSST--Q
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      AA------------------------------------SRSSRDTET--P
I1V161_E1B19K-02          AA------------------------------------SRSSRDTET--P
A0A5P8KYF0_E1B19K-02      AA------------------------------------SRSSRDTET--P
J7I6S4_E1B19K-02          AA------------------------------------SRSSRDTET--P
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          AA------------------------------------SRSSRDTET--P
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      PG------------------------------------DNTDGGAA----
J9Z5H0_E1B19K-02          PG------------------------------------NNTDGG------
A0A1P7YXN8_E1B19K-02      TA------------------------------------SSFGSSSST--Q
A0A1P8C849_E1B19K-02      TA------------------------------------SSFGSSSST--Q
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          TA------------------------------------ARHSEDPES---
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          ------------------------------------------------PS
Q6RK98_E1B19K-03          ------------------------------------------------PP
P04492_E1B19K-02          RG-EGG--GAE--PCGGGEV--NMEQQVQE-G------------------
Q2KSM8_E1B19K-01          ------------------------------------------------ED
M9YVF6_E1B19K-01          ------------------------------------------------SD
T2CI10_E1B19K-01          ------------------------------------------------ED
A0A1W5PVU4_E1B19K-01      ------------------------------------------------EN
A0A3Q9HK00_E1B19K-01      ------------------------------------------------ED
A0A9X9PKC1_E1B19K-01      ------------------------------------------------QS
A0A5K6WAR5_E1B19K-01      ------------------------------------------------ED
T2CI10_E1B19K-02          TD------HAS-GFGG-GAP--RGQSESRP-GPSGG---GG---GGVADL
A0A2H5AIC5_E1B19K-01      ------------------------------------------------RE
A0A0M4N3Z1_E1B19K-01      ------------------------------------------------QT
A0A3S9SPV1_E1B19K-01      ------------------------------------------------ED
A0A9W3HRK4_E1B19K-02      AAEAGG--SGS-HFGG-GERHGREESESGA-GPSGG---GV---GGIPDP
A0A7L4WJT1_E1B19K-01      ------------------------------------------------ED
D3JIR7_E1B19K-02          --AGGGAGAAG--PCG-GEV--NMEQQVQE-G------------------
Q2KSM8_E1B19K-03          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG---G----GGVADL
A0A7U3RVU4_E1B19K-01      ------------------------------------------------QS
F2WTM9_E1B19K-01          ------------------------------------------------QT
A0A0M4NHE0_E1B19K-01      ------------------------------------------------QT
A0A2H4PJ75_E1B19K-01      ------------------------------------------------ED
G0ZAH2_E1B19K-01          ------------------------------------------------ED
P10406_E1B19K-01          ------------------------------------------------ED
M0QU02_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
J9Z4H6_E1B19K-02          AAAAGG--SQA-AAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
P04492_E1B19K-01          ------------------------------------------------QS
A0A898KBW7_E1B19K-01      ------------------------------------------------QS
A0A7L4WG90_E1B19K-01      ------------------------------------------------ED
A0A3S9SND6_E1B19K-01      ------------------------------------------------ED
J7I6T8_E1B19K-02          AAAAGG--SQA-AAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
A0A5H2QAX5_E1B19K-01      ------------------------------------------------QS
Q6QPB7_E1B19K-01          ------------------------------------------------ED
A0A8G1GLF6_E1B19K-01      ------------------------------------------------QS
T1UG63_E1B19K-02          AAAAGG--SQAAAAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
A0A3Q9HJ63_E1B19K-01      ------------------------------------------------ED
T1UEX7_E1B19K-02          ----GG--AAE--HYD-GGV--NMEPQVQE-G------------------
F6KST6_E1B19K-01          ------------------------------------------------EN
A0A482EVC6_E1B19K-02      --------SAG-GGGG-GGG--GGEPEGRS-GSSNG---------IVTEP
A0A3Q9HK78_E1B19K-01      ------------------------------------------------ED
H9AAA8_E1B19K-01          ------------------------------------------------QT
A0MK43_E1B19K-02          ----------G-GGER-AGG--DRESESRP-GPSSG---RL---G--AED
Q32UI6_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
A0A3S6PYX7_E1B19K-01      ------------------------------------------------AD
Q5GFC7_E1B19K-03          -------------PAA-GGS--RRESESRP-GPSGG---------GVADL
A0A3Q9HJ54_E1B19K-01      ------------------------------------------------ED
A0A898KBR0_E1B19K-01      ------------------------------------------------QS
J9Z4N4_E1B19K-01          ------------------------------------------------ED
P10544_E1B19K-01          ------------------------------------------------QS
F4ZCJ8_E1B19K-01          ------------------------------------------------QS
Q8UY91_E1B19K-01          ------------------------------------------------ED
A0A9W3I4N3_E1B19K-01      ------------------------------------------------EN
A0A1L3INW0_E1B19K-01      ------------------------------------------------ED
A0A097IW62_E1B19K-01      ------------------------------------------------EN
A0A3G4W995_E1B19K-01      ------------------------------------------------QS
A0A7D0TLU2_E1B19K-01      ------------------------------------------------ED
G9G841_E1B19K-01          ------------------------------------------------ED
Q6VGV8_E1B19K-02          -AAAGG--SQA--AAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
P06501_E1B19K-01          ------------------------------------------------QT
Q71BY5_E1B19K-01          PPAPGS--PEP-P-HL-SRQ--PEQPEQRALGPVSM---------PNLVP
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------AA-GGS--RRESESRP-GPSGG---------GVADL
E1ARN8_E1B19K-03          ---------QA-AAAA-GAE--PMEPESRP-GPSGM---------NVVQP
Q2KSG6_E1B19K-05          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG--------GGVADL
Q2KSM8_E1B19K-05          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG-------GGGVADL
Q2KSM8_E1B19K-04          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG-------GGGVADL
Q5GFC7_E1B19K-04          --------------AA-GGS--RRESESRP-GPSGG---------GVADL
E1ARN8_E1B19K-04          --------SQA-AAAA-GAE--PMEPESRP-GPSGM---NVVQEGGVPTL
E1U5L6_E1B19K-04          --------SQA-AAAA-GAE--PMEPESRP-GPSGM---NVVQEGGVPTL
A0A1C8EG46_E1B19K-01      ------------------------------------------------QT
W6EIX6_E1B19K-01          ------------------------------------------------ED
W6EIX6_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
Q7T8D8_E1B19K-01          ------------------------------------------------ED
Q7T8D8_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
Q8B8U7_E1B19K-01          ------------------------------------------------ED
Q32UI6_E1B19K-01          ------------------------------------------------ED
B9A5Q1_E1B19K-01          ------------------------------------------------AD
B9A5T7_E1B19K-01          ------------------------------------------------AD
M0QU76_E1B19K-01          ------------------------------------------------AD
M0QU76_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A0B4SJH1_E1B19K-01      ------------------------------------------------ED
A0A0B4SJH1_E1B19K-02      TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
Q2KS85_E1B19K-01          ------------------------------------------------ED
Q2KS85_E1B19K-02          TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
C5HDR2_E1B19K-01          ------------------------------------------------AD
C5HDR2_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
D3GBW3_E1B19K-01          ------------------------------------------------AD
M0QUB4_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
W8CZB0_E1B19K-01          ------------------------------------------------GD
W8CZB0_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVASL
M0QUF3_E1B19K-01          ------------------------------------------------AD
M0QUF3_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QUJ3_E1B19K-01          ------------------------------------------------AD
M0QUJ3_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QUN2_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
C4P207_E1B19K-02          T---NI--HVG-GRNE-TGH--GREPEERP-GPSVGRGAGL---NQVSSL
R4HLJ6_E1B19K-01          ------------------------------------------------ED
R4HLJ6_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
M0QTS5_E1B19K-01          ------------------------------------------------AD
M0QTS5_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QUS9_E1B19K-01          ------------------------------------------------AD
M0QUS9_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
Q3ZL02_E1B19K-01          ------------------------------------------------ED
Q3ZL02_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
M0QV47_E1B19K-01          ------------------------------------------------AD
M0QV47_E1B19K-02          T---NI--HVG-GRDE-GDH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QV87_E1B19K-01          ------------------------------------------------GD
M0QV87_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---SQVSSL
M0QVC7_E1B19K-01          ------------------------------------------------AD
M0QVC7_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QVG6_E1B19K-01          ------------------------------------------------AD
M0QVG6_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QVK6_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
M0QVP5_E1B19K-01          ------------------------------------------------AD
M0QVP5_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERS-GPSVGRGAGL---NQVSSL
Q4KSL0_E1B19K-01          ------------------------------------------------AD
M0QUW8_E1B19K-01          ------------------------------------------------AD
M0QUW8_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A3G9JTX5_E1B19K-01      ------------------------------------------------ED
A0A3G9K5X3_E1B19K-01      ------------------------------------------------ED
A0A3G9CMQ4_E1B19K-01      ------------------------------------------------ED
Q3ZKW2_E1B19K-01          ------------------------------------------------ED
Q3ZKW2_E1B19K-02          TD------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
M0QVT4_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVASL
A0MK43_E1B19K-01          ------------------------------------------------RE
A0A3Q9FFS0_E1B19K-01      ------------------------------------------------AD
A0A3Q9FFS0_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
E5RWD9_E1B19K-01          ------------------------------------------------AD
B9A5L5_E1B19K-01          ------------------------------------------------GE
A0A7G5F9T0_E1B19K-01      ------------------------------------------------ED
A0A7G5FB98_E1B19K-01      ------------------------------------------------ED
A0A7G5FB98_E1B19K-02      TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
C7SRS7_E1B19K-01          ------------------------------------------------ED
A0A1Y1BXT7_E1B19K-01      ------------------------------------------------AD
E9P585_E1B19K-01          ------------------------------------------------AD
E9P585_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
G1FC01_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
G1DE13_E1B19K-01          ------------------------------------------------QS
G1FBW4_E1B19K-01          ------------------------------------------------AD
G1FBW4_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
R4HLA0_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
H5T740_E1B19K-01          ------------------------------------------------AD
K7NG43_E1B19K-02          TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
T1UHL7_E1B19K-01          ------------------------------------------------AD
T1UHL7_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
R4HMC6_E1B19K-01          ------------------------------------------------ED
R4HMC6_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
W8VNG2_E1B19K-01          ------------------------------------------------GD
A0A3G8WH01_E1B19K-01      ------------------------------------------------QS
D3JIR7_E1B19K-01          ------------------------------------------------QS
A0A5H2QAX5_E1B19K-02      ----GG--AAE--HYD-GGV--NMEPQVQE-G------------------
D0Z5R9_E1B19K-01          ------------------------------------------------QS
Q2KRU2_E1B19K-02          TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
R4HLE1_E1B19K-01          ------------------------------------------------ED
R4HLE1_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
Q7T951_E1B19K-01          ------------------------------------------------ED
A0A8B0L9Y2_E1B19K-01      ------------------------------------------------ED
A0A8B0LBX6_E1B19K-01      ------------------------------------------------ED
A0A8B0LCV0_E1B19K-01      ------------------------------------------------ED
A0A8B0LD36_E1B19K-01      ------------------------------------------------ED
Q2Y0J3_E1B19K-01          ------------------------------------------------ED
Q2Y0J3_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
A0A220VZ73_E1B19K-01      ------------------------------------------------ED
P03248_E1B19K-03          TY------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
P03248_E1B19K-02          ------------------------------------------------ED
Q5EY83_E1B19K-01          ------------------------------------------------ED
Q5EY83_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
A0A7D6TSN5_E1B19K-01      ------------------------------------------------ED
Q71BY5_E1B19K-02          PPAPGS--PEP-P-HL-SRQ--PEQPEQRALGPVSM---------PNLVP
Q71BY5_E1B19K-04          ------------------------------------------------ED
A0A1U9ALK7_E1B19K-01      ------------------------------------------------ED
A0A4P2SGW2_E1B19K-02      AAAAGG--SQAAA-AA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
P03246_E1B19K-01          ------------------------------------------------ED
Q6WQ37_E1B19K-01          ------------------------------------------------ED
E1U5L6_E1B19K-02          -ATAGG--SQA-AAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
E1U5L6_E1B19K-03          ---------QA-AAAA-GAE--PMEPESRP-GPSGM---------NVVQP
F1DT57_E1B19K-01          ------------------------------------------------AD
F1DT57_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERS-GPSVGRGVGL---NQVSSL
A0A1P7YWR9_E1B19K-01      ------------------------------------------------GE
A0A1P7YWR9_E1B19K-02      T---NI--HVG-GRNE-GGH--GQEPEERP-GPSVGRGAGL---NEVSSL
A0A1P7YWY2_E1B19K-02      T---NI--HVG-GRNE-GVH--GQEPEERP-GPSVGRGAGL---NEVSSL
A0A1P7YWY2_E1B19K-01      ------------------------------------------------GE
A0A1P7YXN8_E1B19K-01      ------------------------------------------------GE
A0A1P7YYY5_E1B19K-02      T---NI--HVG-GRNK-GGH--GQEPEERP-GPSVGRGAGL---NEVSSL
A0A1P7YYY5_E1B19K-01      ------------------------------------------------GE
A0A1P8C849_E1B19K-01      ------------------------------------------------GE
B9A5A7_E1B19K-01          ------------------------------------------------GE
M0QU02_E1B19K-01          ------------------------------------------------AD
A0A3G8W6L2_E1B19K-01      ------------------------------------------------ED
Q2KSG6_E1B19K-02          ------------------------------------------------ED
Q2KSG6_E1B19K-04          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG--------GGVADL
Q2KSG6_E1B19K-03          ANFPGT--PTP-PAAA-GGS--RREPESRP-GPSGG--------GGVADL
Q5GFC7_E1B19K-02          ------------------------------------------------ED
A0A142G3J2_E1B19K-01      ------------------------------------------------QS
P10543_E1B19K-01          ------------------------------------------------QS
A0A1S6ELT2_E1B19K-01      ------------------------------------------------QS
A0A3G8W407_E1B19K-01      ------------------------------------------------QS
A0A482EVC6_E1B19K-01      ------------------------------------------------QS
A0A7U3RWV6_E1B19K-01      ------------------------------------------------QS
A0A898KBS1_E1B19K-01      ------------------------------------------------QS
A0A513TZR1_E1B19K-01      ------------------------------------------------ED
A0A516UYM9_E1B19K-01      ------------------------------------------------ED
A0A0K0PX35_E1B19K-01      ------------------------------------------------ED
A0A0K0PX99_E1B19K-01      ------------------------------------------------ED
A0A6M6AA96_E1B19K-01      ------------------------------------------------ED
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          ------------------------------------------------ED
J7ID56_E1B19K-01          ------------------------------------------------ED
T1UE63_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
T1UF50_E1B19K-01          ------------------------------------------------ED
T1UIP3_E1B19K-02          TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
T1UJX4_E1B19K-01          ------------------------------------------------ED
T1UJX4_E1B19K-02          TC------HAS-GSGG-GTA--RGQSESRP-GPSSG---G----GGVADL
A0A291P1B2_E1B19K-01      ------------------------------------------------ED
A0A3Q9HJZ5_E1B19K-01      ------------------------------------------------ED
A0A3Q9HLF7_E1B19K-01      ------------------------------------------------ED
A0A3S9SNH4_E1B19K-01      ------------------------------------------------ED
A0A3S9SNY0_E1B19K-01      ------------------------------------------------ED
A0A3S9SP19_E1B19K-01      ------------------------------------------------ED
A0A3S9SSS2_E1B19K-01      ------------------------------------------------ED
A0A6M4W5T4_E1B19K-01      ------------------------------------------------ED
A0A7D0TN91_E1B19K-01      ------------------------------------------------ED
A0A7L4WGT1_E1B19K-01      ------------------------------------------------ED
A0A7L4WIC2_E1B19K-01      ------------------------------------------------ED
A0A7L4WIG2_E1B19K-01      ------------------------------------------------ED
A0A7L4WK62_E1B19K-01      ------------------------------------------------ED
A0A8F9W8V2_E1B19K-01      ------------------------------------------------ED
E1ARN8_E1B19K-02          TAAAGG--SQAAA-AA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
J7I6T8_E1B19K-01          ------------------------------------------------ED
J9Z4N4_E1B19K-02          --AAGG--SQA-AAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
T1UG63_E1B19K-01          ------------------------------------------------ED
A0A075TSZ1_E1B19K-01      ------------------------------------------------AD
A0A097I4T0_E1B19K-01      ------------------------------------------------AD
A0A097I4T0_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSAGRGAGL---NQVSSL
A0A0G2UY10_E1B19K-01      ------------------------------------------------AD
A0A0G2UY10_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A1J0MS84_E1B19K-01      ------------------------------------------------AD
A0A291B0H2_E1B19K-01      ------------------------------------------------GD
A0A384ZUF2_E1B19K-01      ------------------------------------------------AD
A0A384ZUM9_E1B19K-01      ------------------------------------------------AD
A0A384ZUM9_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVASL
F8UFP5_E1B19K-02          T---NI--HVG-GRNE-GGH--GRQPEERP-GPSVGRGAGL---NQVSSL
F8UFP5_E1B19K-01          ------------------------------------------------AD
G3CK71_E1B19K-02          T---NI--HVG-GRNE-AGH--VREPEERP-GPSVGRGAGL---NQVSSL
G3CK71_E1B19K-01          ------------------------------------------------GD
T1UG22_E1B19K-02          T---NI--HVG-GRNE-GGH--GQEPEERP-GPSVGRGAGL---NEVSSL
T1UGT5_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UGT5_E1B19K-01          ------------------------------------------------AD
T1UGU0_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UGX3_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UGX3_E1B19K-01          ------------------------------------------------AD
T1UGY3_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGAGL---NEVSSL
T1UHG3_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UHG3_E1B19K-01          ------------------------------------------------AD
T1UHH6_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UHH6_E1B19K-01          ------------------------------------------------AD
T1UHQ8_E1B19K-01          ------------------------------------------------AD
T1UHQ8_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVASL
T1UHZ2_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAEL---NQVSSL
T1UK99_E1B19K-01          ------------------------------------------------GD
T1UK99_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UKP8_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UKQ0_E1B19K-02          T---NI--HVG-GRDE-GGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UKQ0_E1B19K-01          ------------------------------------------------AD
T1UKV6_E1B19K-01          ------------------------------------------------GD
T1UKV6_E1B19K-02          T---NI--HVG-GRNE-GGH--GREPEERP-GPSVGRGVGL---NQVSSL
T1ULJ8_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1ULJ8_E1B19K-01          ------------------------------------------------AD
T1ULP4_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
X4Y9D2_E1B19K-01          ------------------------------------------------AD
A0A0A1EUB2_E1B19K-01      ------------------------------------------------RE
A0A0A1EUC8_E1B19K-01      ------------------------------------------------RE
A0A0A1EUE4_E1B19K-01      ------------------------------------------------RE
A0A2H5AI21_E1B19K-01      ------------------------------------------------RE
A0A2H5AI40_E1B19K-01      ------------------------------------------------RE
A0A2H5AI99_E1B19K-01      ------------------------------------------------RD
A0A2H5AID8_E1B19K-01      ------------------------------------------------RE
A0A0M3TH18_E1B19K-01      ------------------------------------------------EN
A0A2H4CJZ0_E1B19K-01      ------------------------------------------------QN
H8PFZ1_E1B19K-01          ------------------------------------------------QN
A0A0M3TH31_E1B19K-01      ------------------------------------------------SD
Q6QPF3_E1B19K-01          ------------------------------------------------ED
A0A9W3HRK4_E1B19K-01      ------------------------------------------------EN
F2WTJ7_E1B19K-01          ------------------------------------------------QT
A0A9W3INM3_E1B19K-01      ------------------------------------------------EN
H9AA76_E1B19K-01          ------------------------------------------------QT
H9AAD9_E1B19K-01          ------------------------------------------------QT
H9AAH3_E1B19K-01          ------------------------------------------------QT
H9AAK5_E1B19K-01          ------------------------------------------------QT
H9AAN8_E1B19K-01          ------------------------------------------------QT
M9YVA3_E1B19K-01          ------------------------------------------------QT
Q6QPI9_E1B19K-01          ------------------------------------------------ED
Q8B6X5_E1B19K-01          ------------------------------------------------QT
B5SNR1_E1B19K-01          ------------------------------------------------QS
A0A1L7NRH1_E1B19K-01      ------------------------------------------------ED
Q5UW22_E1B19K-01          ------------------------------------------------ED
J7H4R9_E1B19K-01          ------------------------------------------------ED
D2DM83_E1B19K-01          ------------------------------------------------ED
A0A7U3S224_E1B19K-01      ------------------------------------------------ED
J7I6W7_E1B19K-01          ------------------------------------------------ED
J7I6W7_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
M0QUB4_E1B19K-01          ------------------------------------------------AD
C4P207_E1B19K-01          ------------------------------------------------AD
D4N3H6_E1B19K-01          ------------------------------------------------AD
M0QVK6_E1B19K-01          ------------------------------------------------AD
M0QVT4_E1B19K-01          ------------------------------------------------AD
A0A3G8WIY5_E1B19K-01      ------------------------------------------------AD
T1ULP4_E1B19K-01          ------------------------------------------------AD
A0A7R6T9I9_E1B19K-01      ------------------------------------------------AD
B6C6W8_E1B19K-01          ------------------------------------------------AD
B9A681_E1B19K-01          ------------------------------------------------AD
A0A1Y1BYF1_E1B19K-01      ------------------------------------------------AD
T1UHZ2_E1B19K-01          ------------------------------------------------AD
M0QU41_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A075IQ70_E1B19K-01      ------------------------------------------------ED
A0A075IQ70_E1B19K-02      TG------HAS-GSGG-GAA--GGQSESRP-GPSG---------GGVADL
K7NG43_E1B19K-01          ------------------------------------------------ED
Q2KRU2_E1B19K-01          ------------------------------------------------ED
T1UIP3_E1B19K-01          ------------------------------------------------ED
A0A3S6PYX7_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
G1FC01_E1B19K-01          ------------------------------------------------GD
E5RWL1_E1B19K-01          ------------------------------------------------AD
M0QU41_E1B19K-01          ------------------------------------------------AD
B2VQE3_E1B19K-01          ------------------------------------------------AD
B6DU90_E1B19K-01          ------------------------------------------------AD
M0QUN2_E1B19K-01          ------------------------------------------------AD
E1CIM6_E1B19K-01          ------------------------------------------------AD
E1AI10_E1B19K-01          ------------------------------------------------AD
H0PPE7_E1B19K-01          ------------------------------------------------AD
Q9YL99_E1B19K-01          ------------------------------------------------AD
K7ZLN6_E1B19K-01          ------------------------------------------------AD
E1CIR1_E1B19K-01          ------------------------------------------------AD
E1AI10_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A384ZUF2_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
R4HLA0_E1B19K-01          ------------------------------------------------ED
Q2KSL3_E1B19K-01          ------------------------------------------------ED
A0A5J6CTQ0_E1B19K-01      ------------------------------------------------ED
I6LES1_E1B19K-01          ------------------------------------------------ED
Q2KSL3_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
I6LEP5_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
I6LES1_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
T1UF50_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
M0QV08_E1B19K-01          ------------------------------------------------AD
G9JUV5_E1B19K-01          ------------------------------------------------AD
M0QV08_E1B19K-02          T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
T1UFS4_E1B19K-01          ------------------------------------------------ED
T1UFS4_E1B19K-02          TG------HAS-GSGG-GTA--RGQPESRP-GPSSG---G----GGVADL
X4YVU5_E1B19K-01          ------------------------------------------------AD
E1CIJ0_E1B19K-01          ------------------------------------------------AD
T1UGU0_E1B19K-01          ------------------------------------------------AD
Q2KSM8_E1B19K-02          ------------------------------------------------ED
A0A2R3WNP3_E1B19K-01      ------------------------------------------------ED
Q2KSG6_E1B19K-01          ------------------------------------------------ED
Q5GFC7_E1B19K-01          ------------------------------------------------ED
Q5GFC8_E1B19K-01          ------------------------------------------------ED
Q6H1D7_E1B19K-01          ------------------------------------------------ED
T1UGY3_E1B19K-01          ------------------------------------------------GE
A0A7U3S1T6_E1B19K-01      ------------------------------------------------ED
J7ID56_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
T1UKP8_E1B19K-01          ------------------------------------------------AD
A0A075TSZ1_E1B19K-02      T---NI--HVG-GRNE-AGH--GREPEERP-GPSVGRGAGL---NQVSSL
A0A897JQR0_E1B19K-01      ------------------------------------------------ED
I1V161_E1B19K-01          ------------------------------------------------ED
A0A5P8KYF0_E1B19K-01      ------------------------------------------------ED
J7I6S4_E1B19K-01          ------------------------------------------------ED
A0A897JQR0_E1B19K-02      TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
I1V161_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
A0A5P8KYF0_E1B19K-02      TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
J7I6S4_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
T1UEX7_E1B19K-01          ------------------------------------------------QS
T1UE63_E1B19K-01          ------------------------------------------------ED
Q6RK98_E1B19K-01          ------------------------------------------------ED
J7I6Q4_E1B19K-01          ------------------------------------------------ED
J7I6Q4_E1B19K-02          TD------HAS-GSAG-GAA--GGQSESRP-GPSG---------GGVADL
A0A4P2SGW2_E1B19K-01      ------------------------------------------------ED
E1ARN8_E1B19K-01          ------------------------------------------------ED
A0A6M5E4Y6_E1B19K-01      ------------------------------------------------ED
P03247_E1B19K-01          ------------------------------------------------ED
A0A3G8W3H5_E1B19K-01      ------------------------------------------------ED
E1U5L6_E1B19K-01          ------------------------------------------------ED
A0A516UYI9_E1B19K-01      ------------------------------------------------ED
J9Z5H0_E1B19K-01          ------------------------------------------------ED
Q6VGV8_E1B19K-01          ------------------------------------------------ED
A0A0G2R248_E1B19K-01      ------------------------------------------------ED
A0A0G2R248_E1B19K-02      -AAAGG--SQA--AAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
J9Z5H0_E1B19K-02          -ATAGG--SQA-AAAA-GAE--PMEPESRP-GPSGM---NV---VQVAEL
A0A1P7YXN8_E1B19K-02      T---NI--HVG-GRNE-GGH--GQEPEERP-GPSVGRGAGL---NEVSSL
A0A1P8C849_E1B19K-02      T---NI--HVG-GRNE-GGH--GQEPEERP-GPSVGRGAGL---NEVSSL
T1UG22_E1B19K-01          ------------------------------------------------GE
A0A2L1F392_E1B19K-01      ------------------------------------------------ED
A0A2R3WN16_E1B19K-01      ------------------------------------------------ED
A0A2R3WN62_E1B19K-01      ------------------------------------------------ED
Q6H1D7_E1B19K-02          -------------PAA-GGS--RRESESRP-GPSGG---------GVADL
A0A6M6AEV2_E1B19K-01      ------------------------------------------------QS
A0A6M6AES6_E1B19K-01      ------------------------------------------------QS
A0A9X9P8C6_E1B19K-01      ------------------------------------------------QS
A0A6B9DS29_E1B19K-01      ------------------------------------------------QS
W0S1G8_E1B19K-01          ------------------------------------------------QS
J9Z4H6_E1B19K-01          ------------------------------------------------ED
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      ------------------------------------------------RE
A0A2H5AI72_E1B19K-01      ------------------------------------------------RE
A0A2H5AIL3_E1B19K-01      ------------------------------------------------RE
A0A0M5L3Y4_E1B19K-01      ------------------------------------------------RE
Q5C8R2_E1B19K-01          ------------------------------------------------RE
A0A2H5AII9_E1B19K-01      ------------------------------------------------RE
A0A2H5AIN5_E1B19K-01      ------------------------------------------------RE
A0A2H5AIU0_E1B19K-01      ------------------------------------------------RE
A0A2H5AIL0_E1B19K-01      ------------------------------------------------RE
A0A2H5AIS9_E1B19K-01      ------------------------------------------------RE
A0A2H5AIT6_E1B19K-01      ------------------------------------------------RE
M9YXY5_E1B19K-01          ------------------------------------------------SD
H9AAS0_E1B19K-01          ------------------------------------------------QT
H9AAV3_E1B19K-01          ------------------------------------------------QT
H9AAY5_E1B19K-01          ------------------------------------------------QT
                                                                            

Q7T8D8_E1B19K-03          WAGVRQ-------N------------------------------------
Q6RK98_E1B19K-03          WAGVRQ-------N------------------------------------
P04492_E1B19K-02          -----H-------VLERGEGPS-CADDRDKQEKKES---LKEAAVLSRLT
Q2KSM8_E1B19K-01          FYKTRQ-------LLENA--SNGV--------------------------
M9YVF6_E1B19K-01          YEVLRK-------LLETA--CEKN--------------------------
T2CI10_E1B19K-01          LRQTRQ-------LLENA--SDGV--------------------------
A0A1W5PVU4_E1B19K-01      YNSLRR-------VLEEA--SEDT--------------------------
A0A3Q9HK00_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A9X9PKC1_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A5K6WAR5_E1B19K-01      FFAVRN-------LLEQS--SNST--------------------------
T2CI10_E1B19K-02          FPELRR-------VLTRS--TTSGRDR---GIKRERNPS-G-TNPRSELA
A0A2H5AIC5_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A0M4N3Z1_E1B19K-01      FESTRR-------LLELC--SNRT--------------------------
A0A3S9SPV1_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A9W3HRK4_E1B19K-02      FPELALGAVGGASVVRED--EE-GRQR---GQKREHFE--S-STFLADVT
A0A7L4WJT1_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
D3JIR7_E1B19K-02          -----H-------ALDPEEGPS-CAAV---NIKRER------ETVLSRLA
Q2KSM8_E1B19K-03          FPELRR-------VLTRS--LS-GRER---GIKRERHD--E-TNHRTELT
A0A7U3RVU4_E1B19K-01      YENLRR-------LLELA--SART--------------------------
F2WTM9_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
A0A0M4NHE0_E1B19K-01      FESTRR-------LVELC--SNRS--------------------------
A0A2H4PJ75_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
G0ZAH2_E1B19K-01          FENCRQ-------VLQQA--SKRT--------------------------
P10406_E1B19K-01          FHKTRQ-------LLENA--SNGV--------------------------
M0QU02_E1B19K-02          YPELSR-------VLTNG--SI-G-AR---GVKRERSDGGN-TGMMTELT
J9Z4H6_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEVRNLT
P04492_E1B19K-01          FQSVRQ-------LLQYT--SKNT--------------------------
A0A898KBW7_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A7L4WG90_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3S9SND6_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
J7I6T8_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEVRNLT
A0A5H2QAX5_E1B19K-01      FQSVRQ-------LLQYT--SKNT--------------------------
Q6QPB7_E1B19K-01          FHQTRQ-------LLENS--SEGV--------------------------
A0A8G1GLF6_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
T1UG63_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEVRNLT
A0A3Q9HJ63_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
T1UEX7_E1B19K-02          -----H-------EPDPDEGPS-CAVV-KKRERKES---LK-ETVLNRLT
F6KST6_E1B19K-01          LGSLRR-------LLEEA--SDRT--------------------------
A0A482EVC6_E1B19K-02      DPEE-------------G--TS-SGQR---GEKRKLEN-DG-ADFLKELT
A0A3Q9HK78_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
H9AAA8_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
A0MK43_E1B19K-02          DPEE-------------G--TS-GGAR---KK-QKTE-PEP-RNFLNELT
Q32UI6_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
A0A3S6PYX7_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
Q5GFC7_E1B19K-03          FPELHR-------VLTRS--SS-GRER---GIKRERHD--E-TNHRIELT
A0A3Q9HJ54_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A898KBR0_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
J9Z4N4_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
P10544_E1B19K-01          YQSLRR-------LLELA--SART--------------------------
F4ZCJ8_E1B19K-01          YQSLRR-------LLELA--SART--------------------------
Q8UY91_E1B19K-01          FHKTRQ-------LLENA--SNGV--------------------------
A0A9W3I4N3_E1B19K-01      LSSLRR-------LLEEA--SDRT--------------------------
A0A1L3INW0_E1B19K-01      RSTLRQ-------LLEEA--SNST--------------------------
A0A097IW62_E1B19K-01      YNSLRK-------VVEEA--SEQT--------------------------
A0A3G4W995_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A7D0TLU2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
G9G841_E1B19K-01          LHKTRQ-------LLENA--SNGV--------------------------
Q6VGV8_E1B19K-02          YPELRR-------ILTIT--EDGQGLK---GVKRERGACEA-TEEARNLA
P06501_E1B19K-01          FESTRR-------LLELC--SNRT--------------------------
Q71BY5_E1B19K-01          --EVID--------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          PC------------------------------------------------
E1ARN8_E1B19K-03          --E-----------------------------------------------
Q2KSG6_E1B19K-05          PC------------------------------------------------
Q2KSM8_E1B19K-05          PC------------------------------------------------
Q2KSM8_E1B19K-04          FPELRR--------------------------------------------
Q5GFC7_E1B19K-04          FPELHR--------------------------------------------
E1ARN8_E1B19K-04          PM------------------------------------------------
E1U5L6_E1B19K-04          PM------------------------------------------------
A0A1C8EG46_E1B19K-01      FESTRC-------LLELC--SNRA--------------------------
W6EIX6_E1B19K-01          LRKTRQ-------LLEDA--SDGV--------------------------
W6EIX6_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERACS-G-TDARSELA
Q7T8D8_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
Q7T8D8_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
Q8B8U7_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
Q32UI6_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
B9A5Q1_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
B9A5T7_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QU76_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QU76_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A0B4SJH1_E1B19K-01      LKQTRL-------LLENA--SDGV--------------------------
A0A0B4SJH1_E1B19K-02      FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
Q2KS85_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q2KS85_E1B19K-02          FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
C5HDR2_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
C5HDR2_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
D3GBW3_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QUB4_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
W8CZB0_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
W8CZB0_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
M0QUF3_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QUF3_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QUJ3_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QUJ3_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QUN2_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
C4P207_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
R4HLJ6_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
R4HLJ6_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
M0QTS5_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QTS5_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QUS9_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
M0QUS9_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
Q3ZL02_E1B19K-01          LRKTRQ-------LLEDA--SDGV--------------------------
Q3ZL02_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
M0QV47_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
M0QV47_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
M0QV87_E1B19K-01          FVKTRR-------LVEDS--SDGC--------------------------
M0QV87_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QVC7_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QVC7_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QVG6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QVG6_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QVK6_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
M0QVP5_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
M0QVP5_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
Q4KSL0_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QUW8_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
M0QUW8_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A3G9JTX5_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
A0A3G9K5X3_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
A0A3G9CMQ4_E1B19K-01      FHKTRQ-------LLENA--SNGV--------------------------
Q3ZKW2_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q3ZKW2_E1B19K-02          FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
M0QVT4_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
A0MK43_E1B19K-01          FDVVRR-------LLELA--SDKT--------------------------
A0A3Q9FFS0_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A3Q9FFS0_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
E5RWD9_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
B9A5L5_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
A0A7G5F9T0_E1B19K-01      LRKTRQ-------LLENA--SDGV--------------------------
A0A7G5FB98_E1B19K-01      LRKTRQ-------LLESA--SDGV--------------------------
A0A7G5FB98_E1B19K-02      SPELQR-------VLTGF--TSTGRDR---GVKRERASS-G-TDARSELA
C7SRS7_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
A0A1Y1BXT7_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
E9P585_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E9P585_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
G1FC01_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
G1DE13_E1B19K-01          FQSVRQ-------LLQYT--SKNT--------------------------
G1FBW4_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
G1FBW4_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
R4HLA0_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
H5T740_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
K7NG43_E1B19K-02          FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNLRTELA
T1UHL7_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
T1UHL7_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
R4HMC6_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
R4HMC6_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
W8VNG2_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
A0A3G8WH01_E1B19K-01      FQSVRQ-------LLQYT--SKNT--------------------------
D3JIR7_E1B19K-01          YQGVRQ-------LLQYT--SKNT--------------------------
A0A5H2QAX5_E1B19K-02      -----H-------EPDPDEGPS-CAVV-KKRERKES---LK-EAVLNRLT
D0Z5R9_E1B19K-01          FQSVRQ-------LLQYT--SKNT--------------------------
Q2KRU2_E1B19K-02          FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
R4HLE1_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
R4HLE1_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
Q7T951_E1B19K-01          LRKTRQ-------LLESA--SDGV--------------------------
A0A8B0L9Y2_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
A0A8B0LBX6_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
A0A8B0LCV0_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
A0A8B0LD36_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
Q2Y0J3_E1B19K-01          LRQTKL-------LLENA--SDGV--------------------------
Q2Y0J3_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
A0A220VZ73_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
P03248_E1B19K-03          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
P03248_E1B19K-02          LRQTRL-------LLENA--SDGV--------------------------
Q5EY83_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q5EY83_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
A0A7D6TSN5_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
Q71BY5_E1B19K-02          --EVID--------------------------------------------
Q71BY5_E1B19K-04          FSAVRN-------LLEQS--SNST--------------------------
A0A1U9ALK7_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A4P2SGW2_E1B19K-02      YPELRR-------ILTIT--EDGQGLK---GVKRERGACEA-TEEARNLA
P03246_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
Q6WQ37_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
E1U5L6_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEARNLT
E1U5L6_E1B19K-03          --E-----------------------------------------------
F1DT57_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
F1DT57_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A1P7YWR9_E1B19K-01      FNKTRR-------LVEDS--SDGC--------------------------
A0A1P7YWR9_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
A0A1P7YWY2_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
A0A1P7YWY2_E1B19K-01      FNKTRR-------LVEDS--SDGC--------------------------
A0A1P7YXN8_E1B19K-01      FNKTRR-------LVEDS--SDGC--------------------------
A0A1P7YYY5_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
A0A1P7YYY5_E1B19K-01      FNKTRR-------LVEDS--SDGC--------------------------
A0A1P8C849_E1B19K-01      FNKTRR-------LVEDS--SDGC--------------------------
B9A5A7_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
M0QU02_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
A0A3G8W6L2_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
Q2KSG6_E1B19K-02          FYKTRQ-------LLENA--SNGV--------------------------
Q2KSG6_E1B19K-04          FPELRR--------------------------------------------
Q2KSG6_E1B19K-03          FPELRR-------VLTRS--LS-GRER---GIKRERHD--E-TNHRTELT
Q5GFC7_E1B19K-02          FHKTRQ-------LLENA--SNGV--------------------------
A0A142G3J2_E1B19K-01      YQNLRR-------LLELA--SART--------------------------
P10543_E1B19K-01          YQNLRR-------LLELA--SART--------------------------
A0A1S6ELT2_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A3G8W407_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A482EVC6_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A7U3RWV6_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A898KBS1_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A513TZR1_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A516UYM9_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A0K0PX35_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
A0A0K0PX99_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
A0A6M6AA96_E1B19K-01      LRQTRL-------LIENA--SDGV--------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
J7ID56_E1B19K-01          LKQTRL-------LLENA--SDGV--------------------------
T1UE63_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
T1UF50_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
T1UIP3_E1B19K-02          FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
T1UJX4_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
T1UJX4_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
A0A291P1B2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3Q9HJZ5_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3Q9HLF7_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3S9SNH4_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3S9SNY0_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3S9SP19_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A3S9SSS2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A6M4W5T4_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A7D0TN91_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A7L4WGT1_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A7L4WIC2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A7L4WIG2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A7L4WK62_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A8F9W8V2_E1B19K-01      FSAVRN-------LLKQS--SNST--------------------------
E1ARN8_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEVRNLT
J7I6T8_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
J9Z4N4_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEVRNLT
T1UG63_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
A0A075TSZ1_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A097I4T0_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A097I4T0_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A0G2UY10_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A0G2UY10_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A1J0MS84_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A291B0H2_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A384ZUF2_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A384ZUM9_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
A0A384ZUM9_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
F8UFP5_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
F8UFP5_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
G3CK71_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
G3CK71_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UG22_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
T1UGT5_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UGT5_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UGU0_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
T1UGX3_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UGX3_E1B19K-01          FSQTRR-------LVEDS--SDGC--------------------------
T1UGY3_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTELT
T1UHG3_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UHG3_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
T1UHH6_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UHH6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
T1UHQ8_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
T1UHQ8_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
T1UHZ2_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UK99_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UK99_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
T1UKP8_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UKQ0_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
T1UKQ0_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UKV6_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UKV6_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1ULJ8_E1B19K-02          YPELSK-------VLTT------M-AR---GVKRERSDGGN-TGMMTELT
T1ULJ8_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
T1ULP4_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
X4Y9D2_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
A0A0A1EUB2_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A0A1EUC8_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A0A1EUE4_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AI21_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A2H5AI40_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AI99_E1B19K-01      FDVVRQ-------LLESA--SDKT--------------------------
A0A2H5AID8_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A0M3TH18_E1B19K-01      YNSLRR-------VLEEA--SEDT--------------------------
A0A2H4CJZ0_E1B19K-01      YQSLRH-------LLELA--SART--------------------------
H8PFZ1_E1B19K-01          YQSLRR-------LLELA--SART--------------------------
A0A0M3TH31_E1B19K-01      YEVLRK-------LLETA--CEKT--------------------------
Q6QPF3_E1B19K-01          FHQTRQ-------LLENS--SEGV--------------------------
A0A9W3HRK4_E1B19K-01      LSSLRR-------LLEEA--SDRT--------------------------
F2WTJ7_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
A0A9W3INM3_E1B19K-01      LSSLRR-------LLEEA--SDRT--------------------------
H9AA76_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
H9AAD9_E1B19K-01          FESTRR-------LVELC--SNRS--------------------------
H9AAH3_E1B19K-01          FESTRR-------LVELC--SNRS--------------------------
H9AAK5_E1B19K-01          FESTRR-------LVELC--SNRS--------------------------
H9AAN8_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
M9YVA3_E1B19K-01          FESTRC-------LLELC--SNRD--------------------------
Q6QPI9_E1B19K-01          FHQTRQ-------LLENS--SEGV--------------------------
Q8B6X5_E1B19K-01          FESTRR-------LLELC--SNRT--------------------------
B5SNR1_E1B19K-01          YQSLRR-------LLELA--SART--------------------------
A0A1L7NRH1_E1B19K-01      LRKTRQ-------LLEDA--SDGV--------------------------
Q5UW22_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
J7H4R9_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
D2DM83_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
A0A7U3S224_E1B19K-01      LRKTRQ-------LLENA--SDGV--------------------------
J7I6W7_E1B19K-01          LRKTRQ-------LLENA--SDGV--------------------------
J7I6W7_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
M0QUB4_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
C4P207_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
D4N3H6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QVK6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QVT4_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
A0A3G8WIY5_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
T1ULP4_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
A0A7R6T9I9_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
B6C6W8_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
B9A681_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
A0A1Y1BYF1_E1B19K-01      FSKTRR-------LVEDS--SDGC--------------------------
T1UHZ2_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QU41_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A075IQ70_E1B19K-01      LKQTRL-------LLENA--SDGV--------------------------
A0A075IQ70_E1B19K-02      FPELRR-------VLTRS--TSSGQDR---GIKRERNPS-G-NNSRTELA
K7NG43_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q2KRU2_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
T1UIP3_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
A0A3S6PYX7_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
G1FC01_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
E5RWL1_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QU41_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
B2VQE3_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
B6DU90_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QUN2_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E1CIM6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E1AI10_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
H0PPE7_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
Q9YL99_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
K7ZLN6_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E1CIR1_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E1AI10_E1B19K-02          YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A384ZUF2_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
R4HLA0_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q2KSL3_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
A0A5J6CTQ0_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
I6LES1_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
Q2KSL3_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
I6LEP5_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
I6LES1_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
T1UF50_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
M0QV08_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
G9JUV5_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
M0QV08_E1B19K-02          YPELSR-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
T1UFS4_E1B19K-01          LRKTRQ-------LLEDA--SDGV--------------------------
T1UFS4_E1B19K-02          SPELQR-------VLTGS--TSTGRDR---GVKRERASS-G-TDARSELA
X4YVU5_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
E1CIJ0_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
T1UGU0_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
Q2KSM8_E1B19K-02          FYKTRQ-------LLENA--SNGV--------------------------
A0A2R3WNP3_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
Q2KSG6_E1B19K-01          FYKTRQ-------LLENA--SNGV--------------------------
Q5GFC7_E1B19K-01          FHKTRQ-------LLENA--SNGV--------------------------
Q5GFC8_E1B19K-01          FHKTRQ-------LLENA--SNGV--------------------------
Q6H1D7_E1B19K-01          FHKTRQ-------LLENA--SNGV--------------------------
T1UGY3_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
A0A7U3S1T6_E1B19K-01      LRKTRQ-------LLENA--SDGV--------------------------
J7ID56_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
T1UKP8_E1B19K-01          FSKTRR-------LVEDS--SDGC--------------------------
A0A075TSZ1_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGMMTELT
A0A897JQR0_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
I1V161_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
A0A5P8KYF0_E1B19K-01      LRQTRL-------LLENA--SDGV--------------------------
J7I6S4_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
A0A897JQR0_E1B19K-02      FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
I1V161_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
A0A5P8KYF0_E1B19K-02      FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
J7I6S4_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
T1UEX7_E1B19K-01          FQSVRQ-------LLQYT--SKNT--------------------------
T1UE63_E1B19K-01          LRKTRQ-------LLESA--SDGV--------------------------
Q6RK98_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
J7I6Q4_E1B19K-01          LRQTRL-------LLENA--SDGV--------------------------
J7I6Q4_E1B19K-02          FPELRR-------VLTRS--TTSGQNR---GIKRERNPS-G-NNSRTELA
A0A4P2SGW2_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
E1ARN8_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
A0A6M5E4Y6_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
P03247_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
A0A3G8W3H5_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
E1U5L6_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
A0A516UYI9_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
J9Z5H0_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
Q6VGV8_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
A0A0G2R248_E1B19K-01      FSAVRN-------LLEQS--SNST--------------------------
A0A0G2R248_E1B19K-02      YPELRR-------ILTIT--EDGQGLK---GVKRERGACEA-TEEARNLA
J9Z5H0_E1B19K-02          FPELRR-------ILTIN--EDGQGLK---GVKRERGASEA-TEEARNLT
A0A1P7YXN8_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
A0A1P8C849_E1B19K-02      YPELSK-------VLTS------M-AR---GVKRERSDGGN-TGLMTQLT
T1UG22_E1B19K-01          FNKTRR-------LVEDS--SDGC--------------------------
A0A2L1F392_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
A0A2R3WN16_E1B19K-01      FYKTRQ-------LLENA--SNGV--------------------------
A0A2R3WN62_E1B19K-01      FHKTRQ-------LLENA--SNGV--------------------------
Q6H1D7_E1B19K-02          FPELHR-------VLTRS--SS-GRER---GIKRERHD--E-TNHRIELT
A0A6M6AEV2_E1B19K-01      YQNLRR-------LLELA--SART--------------------------
A0A6M6AES6_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A9X9P8C6_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
A0A6B9DS29_E1B19K-01      YQSLRR-------LLELA--SART--------------------------
W0S1G8_E1B19K-01          YQSLRR-------LLELA--SART--------------------------
J9Z4H6_E1B19K-01          FSAVRN-------LLEQS--SNST--------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A2H5AI72_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A2H5AIL3_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
A0A0M5L3Y4_E1B19K-01      FGVVRR-------LLELA--SDRT--------------------------
Q5C8R2_E1B19K-01          FGVVRR-------LLELA--SDRT--------------------------
A0A2H5AII9_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AIN5_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AIU0_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AIL0_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AIS9_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
A0A2H5AIT6_E1B19K-01      FDVVRR-------LLELA--SDKT--------------------------
M9YXY5_E1B19K-01          YEVLRK-------LLETA--CEKT--------------------------
H9AAS0_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
H9AAV3_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
H9AAY5_E1B19K-01          FESTRC-------LLELC--SNRA--------------------------
                                                                            

Q7T8D8_E1B19K-03          ----------------VMG-------------------------------
Q6RK98_E1B19K-03          ----------------VMG-------------------------------
P04492_E1B19K-02          VNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMEC
Q2KSM8_E1B19K-01          ----------SYLWRFCFG-------------------------------
M9YVF6_E1B19K-01          ----------RSCWRFFFG-------------------------------
T2CI10_E1B19K-01          ----------SGLWRFWFG-------------------------------
A0A1W5PVU4_E1B19K-01      ----------SVWWRRLFG-------------------------------
A0A3Q9HK00_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A9X9PKC1_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A5K6WAR5_E1B19K-01      ----------SWFWRFLWG-------------------------------
T2CI10_E1B19K-02          LSLMSRRRPETIWWHEVQNEGRDEVSILQEKYSLEQVKTCWLEPEDDWEV
A0A2H5AIC5_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A0M4N3Z1_E1B19K-01      ----------SFLWRWLFG-------------------------------
A0A3S9SPV1_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A9W3HRK4_E1B19K-02      VALMAKNRLEVVWYPEVWEDFEKGDLHLLEKYNFEQVKTYWMNPDEDWEV
A0A7L4WJT1_E1B19K-01      ----------SWFWRFLWG-------------------------------
D3JIR7_E1B19K-02          VNIMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQLKTHWLEPWEDIES
Q2KSM8_E1B19K-03          VGLMSRKRPETVWWHEVQLTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEV
A0A7U3RVU4_E1B19K-01      ----------SSCWRILFG-------------------------------
F2WTM9_E1B19K-01          ----------SWWKRLLFG-------------------------------
A0A0M4NHE0_E1B19K-01      ----------SWFGRFLFG-------------------------------
A0A2H4PJ75_E1B19K-01      ----------SWFWRFLWG-------------------------------
G0ZAH2_E1B19K-01          ----------GGWSRWLLG-------------------------------
P10406_E1B19K-01          ----------SHLWRFCFG-------------------------------
M0QU02_E1B19K-02          ASLMNRKRPECITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
J9Z4H6_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
P04492_E1B19K-01          ----------SGFWRYLFG-------------------------------
A0A898KBW7_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A7L4WG90_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3S9SND6_E1B19K-01      ----------SWFWRFLWG-------------------------------
J7I6T8_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
A0A5H2QAX5_E1B19K-01      ----------SGFWRYLFG-------------------------------
Q6QPB7_E1B19K-01          ----------SYLWRFCFG-------------------------------
A0A8G1GLF6_E1B19K-01      ----------SSCWRFIFG-------------------------------
T1UG63_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
A0A3Q9HJ63_E1B19K-01      ----------SWFWRFLWG-------------------------------
T1UEX7_E1B19K-02          VNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLEC
F6KST6_E1B19K-01          ----------SYFWRFLCG-------------------------------
A0A482EVC6_E1B19K-02      LSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWEL
A0A3Q9HK78_E1B19K-01      ----------SWFWRFLWG-------------------------------
H9AAA8_E1B19K-01          ----------SWWKRLLFG-------------------------------
A0MK43_E1B19K-02          VSLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEM
Q32UI6_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
A0A3S6PYX7_E1B19K-01      ----------SGFWRHWFG-------------------------------
Q5GFC7_E1B19K-03          VGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEV
A0A3Q9HJ54_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A898KBR0_E1B19K-01      ----------SSCWRFIFG-------------------------------
J9Z4N4_E1B19K-01          ----------SWFWRFLWG-------------------------------
P10544_E1B19K-01          ----------SSCWRFIFG-------------------------------
F4ZCJ8_E1B19K-01          ----------SSCWRFIFG-------------------------------
Q8UY91_E1B19K-01          ----------SYLWRFCFG-------------------------------
A0A9W3I4N3_E1B19K-01      ----------SYIWRFLFG-------------------------------
A0A1L3INW0_E1B19K-01      ----------SYCWRFLFG-------------------------------
A0A097IW62_E1B19K-01      ----------SGWWRKLFG-------------------------------
A0A3G4W995_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A7D0TLU2_E1B19K-01      ----------SKTKRLLLS-------------------------------
G9G841_E1B19K-01          ----------SHLWRFCFG-------------------------------
Q6VGV8_E1B19K-02          FSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
P06501_E1B19K-01          ----------SFLWRWLFG-------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ----------SWWKRLLFG-------------------------------
W6EIX6_E1B19K-01          ----------SGFWRFWFA-------------------------------
W6EIX6_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
Q7T8D8_E1B19K-01          ----------SGFWRFWFA-------------------------------
Q7T8D8_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
Q8B8U7_E1B19K-01          ----------SGFWRFWFA-------------------------------
Q32UI6_E1B19K-01          ----------SGFWRFWFA-------------------------------
B9A5Q1_E1B19K-01          ----------SGFWRHWFG-------------------------------
B9A5T7_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QU76_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QU76_E1B19K-02          ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
A0A0B4SJH1_E1B19K-01      ----------SGFWRFWFG-------------------------------
A0A0B4SJH1_E1B19K-02      LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
Q2KS85_E1B19K-01          ----------SGFWRFWFG-------------------------------
Q2KS85_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
C5HDR2_E1B19K-01          ----------SGFWRHWFG-------------------------------
C5HDR2_E1B19K-02          ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
D3GBW3_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUB4_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
W8CZB0_E1B19K-01          ----------SGFWRHWFG-------------------------------
W8CZB0_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
M0QUF3_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUF3_E1B19K-02          ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
M0QUJ3_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUJ3_E1B19K-02          ASLMNRKRPERITWHELQMECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
M0QUN2_E1B19K-02          ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
C4P207_E1B19K-02          ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
R4HLJ6_E1B19K-01          ----------SGLWRFWFG-------------------------------
R4HLJ6_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
M0QTS5_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QTS5_E1B19K-02          ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
M0QUS9_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUS9_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
Q3ZL02_E1B19K-01          ----------SGFWRFWFA-------------------------------
Q3ZL02_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
M0QV47_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QV47_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
M0QV87_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QV87_E1B19K-02          ASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
M0QVC7_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QVC7_E1B19K-02          ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
M0QVG6_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QVG6_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
M0QVK6_E1B19K-02          ASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
M0QVP5_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QVP5_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
Q4KSL0_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUW8_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUW8_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0A3G9JTX5_E1B19K-01      ----------SYLWRFCFG-------------------------------
A0A3G9K5X3_E1B19K-01      ----------SYLWRFCFG-------------------------------
A0A3G9CMQ4_E1B19K-01      ----------SYLWRFCFG-------------------------------
Q3ZKW2_E1B19K-01          ----------SGFWRFWFG-------------------------------
Q3ZKW2_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
M0QVT4_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0MK43_E1B19K-01          ----------SRLWRFWFG-------------------------------
A0A3Q9FFS0_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A3Q9FFS0_E1B19K-02      ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
E5RWD9_E1B19K-01          ----------SGFWRHWFG-------------------------------
B9A5L5_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A7G5F9T0_E1B19K-01      ----------SGFWRFWFA-------------------------------
A0A7G5FB98_E1B19K-01      ----------SGFWRFWFA-------------------------------
A0A7G5FB98_E1B19K-02      LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
C7SRS7_E1B19K-01          ----------SGFWRFWFA-------------------------------
A0A1Y1BXT7_E1B19K-01      ----------SGFWRHWFG-------------------------------
E9P585_E1B19K-01          ----------SGFWRHWFG-------------------------------
E9P585_E1B19K-02          ASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
G1FC01_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
G1DE13_E1B19K-01          ----------SGFWRYLFG-------------------------------
G1FBW4_E1B19K-01          ----------SGFWRHWFG-------------------------------
G1FBW4_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
R4HLA0_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
H5T740_E1B19K-01          ----------SGFWRHWFG-------------------------------
K7NG43_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
T1UHL7_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UHL7_E1B19K-02          ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
R4HMC6_E1B19K-01          ----------SGLWRFWFG-------------------------------
R4HMC6_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
W8VNG2_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A3G8WH01_E1B19K-01      ----------SGFWRYLFG-------------------------------
D3JIR7_E1B19K-01          ----------SGFWRYLFG-------------------------------
A0A5H2QAX5_E1B19K-02      VNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLEC
D0Z5R9_E1B19K-01          ----------SGFWRYLFG-------------------------------
Q2KRU2_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
R4HLE1_E1B19K-01          ----------SGLWRFWFG-------------------------------
R4HLE1_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
Q7T951_E1B19K-01          ----------SGFWRFWFA-------------------------------
A0A8B0L9Y2_E1B19K-01      ----------SGLWRFWFG-------------------------------
A0A8B0LBX6_E1B19K-01      ----------SGLWRFWFG-------------------------------
A0A8B0LCV0_E1B19K-01      ----------SGFWRFWFG-------------------------------
A0A8B0LD36_E1B19K-01      ----------SGLWRFWFG-------------------------------
Q2Y0J3_E1B19K-01          ----------SGLWRFWFG-------------------------------
Q2Y0J3_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
A0A220VZ73_E1B19K-01      ----------SGLWRFCFG-------------------------------
P03248_E1B19K-03          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
P03248_E1B19K-02          ----------SGLWRFWFG-------------------------------
Q5EY83_E1B19K-01          ----------SGLWRFWFG-------------------------------
Q5EY83_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
A0A7D6TSN5_E1B19K-01      ----------SWFWRFLWG-------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          ----------SWFWRFLWG-------------------------------
A0A1U9ALK7_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A4P2SGW2_E1B19K-02      FSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
P03246_E1B19K-01          ----------SWFWRFLWG-------------------------------
Q6WQ37_E1B19K-01          ----------SWFWRFLWG-------------------------------
E1U5L6_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          ----------SGFWRHWFG-------------------------------
F1DT57_E1B19K-02          ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1P7YWR9_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A1P7YWR9_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1P7YWY2_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1P7YWY2_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A1P7YXN8_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A1P7YYY5_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1P7YYY5_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A1P8C849_E1B19K-01      ----------SGFWRHWFG-------------------------------
B9A5A7_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QU02_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A3G8W6L2_E1B19K-01      ----------SYLWRFCFG-------------------------------
Q2KSG6_E1B19K-02          ----------SYLWRFCFG-------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          VGLMSRKRPETVWWHEVQMTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEV
Q5GFC7_E1B19K-02          ----------SYLWRFCFG-------------------------------
A0A142G3J2_E1B19K-01      ----------SSCWRILFG-------------------------------
P10543_E1B19K-01          ----------SSCWRILFG-------------------------------
A0A1S6ELT2_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A3G8W407_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A482EVC6_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A7U3RWV6_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A898KBS1_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A513TZR1_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A516UYM9_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A0K0PX35_E1B19K-01      ----------SGLWRFWFG-------------------------------
A0A0K0PX99_E1B19K-01      ----------SGLWRFWFG-------------------------------
A0A6M6AA96_E1B19K-01      ----------SGLWRFWFG-------------------------------
I6LEP5_E1B19K-03          ---MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
I6LEP5_E1B19K-01          ----------SGLWRFWFG-------------------------------
J7ID56_E1B19K-01          ----------SGLWRFWFG-------------------------------
T1UE63_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
T1UF50_E1B19K-01          ----------SGLWRFWFG-------------------------------
T1UIP3_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
T1UJX4_E1B19K-01          ----------SGFWRFWFA-------------------------------
T1UJX4_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
A0A291P1B2_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3Q9HJZ5_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3Q9HLF7_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3S9SNH4_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3S9SNY0_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3S9SP19_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A3S9SSS2_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A6M4W5T4_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A7D0TN91_E1B19K-01      ----------SWFWRVLWG-------------------------------
A0A7L4WGT1_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A7L4WIC2_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A7L4WIG2_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A7L4WK62_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A8F9W8V2_E1B19K-01      ----------SWFWRFLWG-------------------------------
E1ARN8_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
J7I6T8_E1B19K-01          ----------SWFWRFLWG-------------------------------
J9Z4N4_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
T1UG63_E1B19K-01          ----------SWFWRFLWG-------------------------------
A0A075TSZ1_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A097I4T0_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A097I4T0_E1B19K-02      ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
A0A0G2UY10_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A0G2UY10_E1B19K-02      ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1J0MS84_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A291B0H2_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A384ZUF2_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A384ZUM9_E1B19K-01      ----------SGFWRHWFG-------------------------------
A0A384ZUM9_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
F8UFP5_E1B19K-02          ASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
F8UFP5_E1B19K-01          ----------SGFWRHWFG-------------------------------
G3CK71_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
G3CK71_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UG22_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UGT5_E1B19K-02          ASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
T1UGT5_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UGU0_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UGX3_E1B19K-02          ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
T1UGX3_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UGY3_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UHG3_E1B19K-02          ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
T1UHG3_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UHH6_E1B19K-02          ASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UHH6_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UHQ8_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UHQ8_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UHZ2_E1B19K-02          ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
T1UK99_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UK99_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UKP8_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UKQ0_E1B19K-02          ASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UKQ0_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UKV6_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UKV6_E1B19K-02          ASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
T1ULJ8_E1B19K-02          ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1ULJ8_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1ULP4_E1B19K-02          ASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
X4Y9D2_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A0A1EUB2_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A0A1EUC8_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A0A1EUE4_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AI21_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A2H5AI40_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AI99_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A2H5AID8_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A0M3TH18_E1B19K-01      ----------SVWWRKLFG-------------------------------
A0A2H4CJZ0_E1B19K-01      ----------STCWRFCFG-------------------------------
H8PFZ1_E1B19K-01          ----------STCWRFCFG-------------------------------
A0A0M3TH31_E1B19K-01      ----------SSCWRFFFG-------------------------------
Q6QPF3_E1B19K-01          ----------SYLWRFCFG-------------------------------
A0A9W3HRK4_E1B19K-01      ----------SYIWRFLFG-------------------------------
F2WTJ7_E1B19K-01          ----------SWWKRLLFG-------------------------------
A0A9W3INM3_E1B19K-01      ----------SYIWRFLFG-------------------------------
H9AA76_E1B19K-01          ----------SWWKRLLFG-------------------------------
H9AAD9_E1B19K-01          ----------SWFGRFLFG-------------------------------
H9AAH3_E1B19K-01          ----------SWFGRFLFG-------------------------------
H9AAK5_E1B19K-01          ----------SWFGRFLFG-------------------------------
H9AAN8_E1B19K-01          ----------SWWKRLLFG-------------------------------
M9YVA3_E1B19K-01          ----------PWWKRLLFG-------------------------------
Q6QPI9_E1B19K-01          ----------SYLWRFCFG-------------------------------
Q8B6X5_E1B19K-01          ----------SFLWRWLFG-------------------------------
B5SNR1_E1B19K-01          ----------SSCWRFIFG-------------------------------
A0A1L7NRH1_E1B19K-01      ----------SGFWRFWFA-------------------------------
Q5UW22_E1B19K-01          ----------SGFWRFWFA-------------------------------
J7H4R9_E1B19K-01          ----------SGFWRFWFA-------------------------------
D2DM83_E1B19K-01          ----------SGFWRFWFA-------------------------------
A0A7U3S224_E1B19K-01      ----------SGFWRFWFA-------------------------------
J7I6W7_E1B19K-01          ----------SGFWRFWFA-------------------------------
J7I6W7_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
M0QUB4_E1B19K-01          ----------SGFWRHWFG-------------------------------
C4P207_E1B19K-01          ----------SGFWRHWFG-------------------------------
D4N3H6_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QVK6_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QVT4_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A3G8WIY5_E1B19K-01      ----------SGFWRHWFG-------------------------------
T1ULP4_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A7R6T9I9_E1B19K-01      ----------SGFWRHWFG-------------------------------
B6C6W8_E1B19K-01          ----------SGFWRHWFG-------------------------------
B9A681_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A1Y1BYF1_E1B19K-01      ----------SGFWRHWFG-------------------------------
T1UHZ2_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QU41_E1B19K-02          ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
A0A075IQ70_E1B19K-01      ----------SGFWRFWFG-------------------------------
A0A075IQ70_E1B19K-02      LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
K7NG43_E1B19K-01          ----------SGFWRFWFG-------------------------------
Q2KRU2_E1B19K-01          ----------SGFWRFWFG-------------------------------
T1UIP3_E1B19K-01          ----------SGFWRFWFG-------------------------------
A0A3S6PYX7_E1B19K-02      ASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
G1FC01_E1B19K-01          ----------SGFWRHWFG-------------------------------
E5RWL1_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QU41_E1B19K-01          ----------SGFWRHWFG-------------------------------
B2VQE3_E1B19K-01          ----------SGFWRHWFG-------------------------------
B6DU90_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QUN2_E1B19K-01          ----------SGFWRHWFG-------------------------------
E1CIM6_E1B19K-01          ----------SGFWRHWFG-------------------------------
E1AI10_E1B19K-01          ----------SGFWRHWFG-------------------------------
H0PPE7_E1B19K-01          ----------SGFWRHWFG-------------------------------
Q9YL99_E1B19K-01          ----------SGFWRHWFG-------------------------------
K7ZLN6_E1B19K-01          ----------SGFWRHWFG-------------------------------
E1CIR1_E1B19K-01          ----------SGFWRHWFG-------------------------------
E1AI10_E1B19K-02          ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
A0A384ZUF2_E1B19K-02      ASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEE
R4HLA0_E1B19K-01          ----------SGLWRFWFG-------------------------------
Q2KSL3_E1B19K-01          ----------SGLWRFWFG-------------------------------
A0A5J6CTQ0_E1B19K-01      ----------SGLWRFWFG-------------------------------
I6LES1_E1B19K-01          ----------SGLWRFWFG-------------------------------
Q2KSL3_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
I6LEP5_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
I6LES1_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
T1UF50_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
M0QV08_E1B19K-01          ----------SGFWRHWFG-------------------------------
G9JUV5_E1B19K-01          ----------SGFWRHWFG-------------------------------
M0QV08_E1B19K-02          ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
T1UFS4_E1B19K-01          ----------SGFWRFWFA-------------------------------
T1UFS4_E1B19K-02          LSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEV
X4YVU5_E1B19K-01          ----------SGFWRHWFG-------------------------------
E1CIJ0_E1B19K-01          ----------SGFWRHWFG-------------------------------
T1UGU0_E1B19K-01          ----------SGFWRHWFG-------------------------------
Q2KSM8_E1B19K-02          ----------SYLWRFCFG-------------------------------
A0A2R3WNP3_E1B19K-01      ----------SYLWRFCFG-------------------------------
Q2KSG6_E1B19K-01          ----------SYLWRFCFG-------------------------------
Q5GFC7_E1B19K-01          ----------SYLWRFCFG-------------------------------
Q5GFC8_E1B19K-01          ----------SYLWRFCFG-------------------------------
Q6H1D7_E1B19K-01          ----------SYLWRFCFG-------------------------------
T1UGY3_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A7U3S1T6_E1B19K-01      ----------SGFWRFWFA-------------------------------
J7ID56_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
T1UKP8_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A075TSZ1_E1B19K-02      ASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEE
A0A897JQR0_E1B19K-01      ----------SGLWRFWFG-------------------------------
I1V161_E1B19K-01          ----------SGLWRFWFG-------------------------------
A0A5P8KYF0_E1B19K-01      ----------SGLWRFWFG-------------------------------
J7I6S4_E1B19K-01          ----------SGLWRFWFG-------------------------------
A0A897JQR0_E1B19K-02      LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
I1V161_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
A0A5P8KYF0_E1B19K-02      LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
J7I6S4_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
T1UEX7_E1B19K-01          ----------SGFWRYLFG-------------------------------
T1UE63_E1B19K-01          ----------SGFWRFWFA-------------------------------
Q6RK98_E1B19K-01          ----------SGLWRFWFG-------------------------------
J7I6Q4_E1B19K-01          ----------SGLWRFWFG-------------------------------
J7I6Q4_E1B19K-02          LSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
A0A4P2SGW2_E1B19K-01      ----------SWFWRFLWG-------------------------------
E1ARN8_E1B19K-01          ----------SWFWRFLWG-------------------------------
A0A6M5E4Y6_E1B19K-01      ----------SWFWRFLWG-------------------------------
P03247_E1B19K-01          ----------SWFWRFLWG-------------------------------
A0A3G8W3H5_E1B19K-01      ----------SWFWRFLWG-------------------------------
E1U5L6_E1B19K-01          ----------SWFWRFLWG-------------------------------
A0A516UYI9_E1B19K-01      ----------SWFWRFLWG-------------------------------
J9Z5H0_E1B19K-01          ----------SWFWRFLWG-------------------------------
Q6VGV8_E1B19K-01          ----------SWFWRFLWG-------------------------------
A0A0G2R248_E1B19K-01      ----------SWFWRFLWG-------------------------------
A0A0G2R248_E1B19K-02      FSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
J9Z5H0_E1B19K-02          FSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEE
A0A1P7YXN8_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
A0A1P8C849_E1B19K-02      ASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEE
T1UG22_E1B19K-01          ----------SGFWRHWFG-------------------------------
A0A2L1F392_E1B19K-01      ----------SYLWRFCFG-------------------------------
A0A2R3WN16_E1B19K-01      ----------SYLWRFCFG-------------------------------
A0A2R3WN62_E1B19K-01      ----------SYLWRFCFG-------------------------------
Q6H1D7_E1B19K-02          VGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEV
A0A6M6AEV2_E1B19K-01      ----------SSCWRILFG-------------------------------
A0A6M6AES6_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A9X9P8C6_E1B19K-01      ----------SSCWRFIFG-------------------------------
A0A6B9DS29_E1B19K-01      ----------SSCWRFIFG-------------------------------
W0S1G8_E1B19K-01          ----------SSCWRFIFG-------------------------------
J9Z4H6_E1B19K-01          ----------SWFWRFLWG-------------------------------
I6LES1_E1B19K-03          ---MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEV
A0A2H5AI04_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A2H5AI72_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A2H5AIL3_E1B19K-01      ----------SKFWRFCFG-------------------------------
A0A0M5L3Y4_E1B19K-01      ----------SKFWRFCFG-------------------------------
Q5C8R2_E1B19K-01          ----------SKFWRFCFG-------------------------------
A0A2H5AII9_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AIN5_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AIU0_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AIL0_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AIS9_E1B19K-01      ----------SRLWRFWFG-------------------------------
A0A2H5AIT6_E1B19K-01      ----------SRLWRFWFG-------------------------------
M9YXY5_E1B19K-01          ----------SSCWRFFFG-------------------------------
H9AAS0_E1B19K-01          ----------SWWKRLLFG-------------------------------
H9AAV3_E1B19K-01          ----------SWWKRLLFG-------------------------------
H9AAY5_E1B19K-01          ----------SWWKRLLFG-------------------------------
                                                                            

Q7T8D8_E1B19K-03          --STVDGRPVQPANSSTLTY----------------------------A-
Q6RK98_E1B19K-03          --STVDGRPVQPANSSTLTY----------------------------A-
P04492_E1B19K-02          AIKAFAKLALRPDCSYRITKTVTITSCAYIIGNGAEVEVDTSDRVAFRCR
Q2KSM8_E1B19K-01          --GDLAKLVYRTKQDYKEQF----------------------------DD
M9YVF6_E1B19K-01          --STLSNVVHRVKREHSEEF----------------------------SR
T2CI10_E1B19K-01          --GDLARLVFRIKQDYRQEF----------------------------EK
A0A1W5PVU4_E1B19K-01      --CRVSQLVVQAKVEYKEEF----------------------------EK
A0A3Q9HK00_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A9X9PKC1_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A5K6WAR5_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
T2CI10_E1B19K-02          AIRNYAKIALRPDKLYRITKRINIRNACYISGNGAEVVIDTQDRTVFRCC
A0A2H5AIC5_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A0M4N3Z1_E1B19K-01      --TPLSRLVRQVKLEYEKDF----------------------------ER
A0A3S9SPV1_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A9W3HRK4_E1B19K-02      VLNRYGKVALRPDCRYQVRDKVVLRRNVYLLGNGATVEMVDPRRGGFVAN
A0A7L4WJT1_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
D3JIR7_E1B19K-02          AIKTFAKLALRPDRSYKISKTITIASYAYIIGNGAIIEVDTSDRVAFRCR
Q2KSM8_E1B19K-03          AIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCC
A0A7U3RVU4_E1B19K-01      --STLANVIYRAKEEYSSRF----------------------------AD
F2WTM9_E1B19K-01          --TSLCRLVRQVKEEYESEF----------------------------EH
A0A0M4NHE0_E1B19K-01      --STLCRVVRQVKEEYQSEF----------------------------EH
A0A2H4PJ75_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
G0ZAH2_E1B19K-01          --NQLVRTVAQVKTDYSEHF----------------------------EQ
P10406_E1B19K-01          --GDLAKLVYRAKQDYREQF----------------------------ED
M0QU02_E1B19K-02          AIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
J9Z4H6_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
P04492_E1B19K-01          --STLSKVVNRVKEDYREEF----------------------------EN
A0A898KBW7_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A7L4WG90_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A3S9SND6_E1B19K-01      --SSQAKLVCRVKEDYKWEF----------------------------EE
J7I6T8_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
A0A5H2QAX5_E1B19K-01      --STLSKVVHRVKEDYREEF----------------------------EN
Q6QPB7_E1B19K-01          --GPLAKLVYRAKQDYKDQF----------------------------ED
A0A8G1GLF6_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
T1UG63_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
A0A3Q9HJ63_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
T1UEX7_E1B19K-02          AIKAFAKVALRPDCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCR
F6KST6_E1B19K-01          --SPLSRFLNRVKREHRAEF----------------------------DE
A0A482EVC6_E1B19K-02      ALNMFAKVALRPDTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNCA
A0A3Q9HK78_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
H9AAA8_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
A0MK43_E1B19K-02          ALDTFAKVALRPDKVYTIRRTVNIKKSVYVIGHGALVQVQTPDRVAFNCG
Q32UI6_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCC
A0A3S6PYX7_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
Q5GFC7_E1B19K-03          AIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCC
A0A3Q9HJ54_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A898KBR0_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
J9Z4N4_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
P10544_E1B19K-01          --STLTNVIYRAKEDYSSRF----------------------------AE
F4ZCJ8_E1B19K-01          --STLTNVIYRAKEDYSSRF----------------------------AE
Q8UY91_E1B19K-01          --GDLARLVYRAKQDYSEQF----------------------------EV
A0A9W3I4N3_E1B19K-01      --SPLSRFLYRVKREHLTEF----------------------------DG
A0A1L3INW0_E1B19K-01      --SPLGRFLYRVKKDHQEEF----------------------------DQ
A0A097IW62_E1B19K-01      --CRLSCLVVQAKFEYREEF----------------------------ER
A0A3G4W995_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A7D0TLU2_E1B19K-01      --SFQPKLVCRIKEDYKWEF----------------------------EE
G9G841_E1B19K-01          --GDLAKLVYRAKQDYSEQF----------------------------EV
Q6VGV8_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
P06501_E1B19K-01          --TPLSRLVRQVKLEYEKDF----------------------------ER
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --TSLCRLVRQVKEEYQSEF----------------------------EH
W6EIX6_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
W6EIX6_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCC
Q7T8D8_E1B19K-01          --SELARVVFRIKQDYKQEF----------------------------EK
Q7T8D8_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCC
Q8B8U7_E1B19K-01          --SELARVVFRIKQDYNQEF----------------------------EK
Q32UI6_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
B9A5Q1_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
B9A5T7_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QU76_E1B19K-01          --TPLSRLVYTVKKDYNEEI----------------------------EN
M0QU76_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A0B4SJH1_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A0B4SJH1_E1B19K-02      AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCC
Q2KS85_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q2KS85_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
C5HDR2_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
C5HDR2_E1B19K-02          AIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
D3GBW3_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QUB4_E1B19K-02          AIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCC
W8CZB0_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
W8CZB0_E1B19K-02          AIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCC
M0QUF3_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QUF3_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
M0QUJ3_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
M0QUJ3_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
M0QUN2_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
C4P207_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
R4HLJ6_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
R4HLJ6_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
M0QTS5_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QTS5_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCC
M0QUS9_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
M0QUS9_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
Q3ZL02_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
Q3ZL02_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCC
M0QV47_E1B19K-01          --TPLARLVYTVKKDYQEEF----------------------------EN
M0QV47_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
M0QV87_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
M0QV87_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVVDTLDKAAFRCC
M0QVC7_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QVC7_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
M0QVG6_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QVG6_E1B19K-02          AIKKYAKIALRPDCKYKVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
M0QVK6_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
M0QVP5_E1B19K-01          --TPLSRLVYTVKKDYQEEF----------------------------EN
M0QVP5_E1B19K-02          AIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
Q4KSL0_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QUW8_E1B19K-01          --TPLARLVYTVKKDYQEEF----------------------------EN
M0QUW8_E1B19K-02          AIKKYAKIALRPDCKYRVTKTINIRHACYISGNGAEVIIDTLDKAAFRCC
A0A3G9JTX5_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
A0A3G9K5X3_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
A0A3G9CMQ4_E1B19K-01      --GDLAKLVYRAKQDYREQF----------------------------ED
Q3ZKW2_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q3ZKW2_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
M0QVT4_E1B19K-02          AIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCC
A0MK43_E1B19K-01          --STLSSVVYRVKREQEAQF----------------------------AR
A0A3Q9FFS0_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A3Q9FFS0_E1B19K-02      AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
E5RWD9_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
B9A5L5_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A7G5F9T0_E1B19K-01      --SELARVVFRIKQDYKEEF----------------------------EK
A0A7G5FB98_E1B19K-01      --SELARVVFRIKQDYKEEF----------------------------EK
A0A7G5FB98_E1B19K-02      AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCC
C7SRS7_E1B19K-01          --SEIARVVFRIKQDYKEEF----------------------------EK
A0A1Y1BXT7_E1B19K-01      --TPLSRLVYTVKKDYKEEF----------------------------EN
E9P585_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
E9P585_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
G1FC01_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
G1DE13_E1B19K-01          --STFSKVVHRVKEDYREEF----------------------------EN
G1FBW4_E1B19K-01          --SPLSRLVYTVKKDYQEEF----------------------------EN
G1FBW4_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
R4HLA0_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
H5T740_E1B19K-01          --TPLARLVYTVKKDYQDEF----------------------------EN
K7NG43_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYILGNGAEVIIDTQDKAAFRCC
T1UHL7_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
T1UHL7_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
R4HMC6_E1B19K-01          --GDLARLVFRIKQDYSVEF----------------------------EK
R4HMC6_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
W8VNG2_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A3G8WH01_E1B19K-01      --STLSKVVNRVKEDYREEF----------------------------EN
D3JIR7_E1B19K-01          --STLCKVVHRVKEDYRKEF----------------------------EN
A0A5H2QAX5_E1B19K-02      AIKAFAKVALRPDCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCR
D0Z5R9_E1B19K-01          --STLSKVVHRVKEDYREEF----------------------------EN
Q2KRU2_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
R4HLE1_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
R4HLE1_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
Q7T951_E1B19K-01          --SELARVVFRIKQDYKQEF----------------------------EK
A0A8B0L9Y2_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A8B0LBX6_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A8B0LCV0_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A8B0LD36_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
Q2Y0J3_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q2Y0J3_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAVFRCC
A0A220VZ73_E1B19K-01      --GDLARLVFRIKQDYSVEF----------------------------EK
P03248_E1B19K-03          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
P03248_E1B19K-02          --GDLARLVFRIKQDYSVEF----------------------------EK
Q5EY83_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q5EY83_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
A0A7D6TSN5_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A1U9ALK7_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A4P2SGW2_E1B19K-02      AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
P03246_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
Q6WQ37_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
E1U5L6_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
F1DT57_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A1P7YWR9_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A1P7YWR9_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
A0A1P7YWY2_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
A0A1P7YWY2_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A1P7YXN8_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A1P7YYY5_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
A0A1P7YYY5_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A1P8C849_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
B9A5A7_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
M0QU02_E1B19K-01          --TPLSRLVYTVKKDYQEEF----------------------------EN
A0A3G8W6L2_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
Q2KSG6_E1B19K-02          --GDLAKLVYRTKQDYKEQF----------------------------DD
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          AIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCC
Q5GFC7_E1B19K-02          --GDLAKLVYRAKQDYREQF----------------------------ED
A0A142G3J2_E1B19K-01      --STLANVIYRAKEEYSSRF----------------------------AD
P10543_E1B19K-01          --STLTNVIYRAKEEYSSRF----------------------------AD
A0A1S6ELT2_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A3G8W407_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A482EVC6_E1B19K-01      --STLTNVIYRAKEDYSSQF----------------------------AE
A0A7U3RWV6_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A898KBS1_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A513TZR1_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A516UYM9_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A0K0PX35_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A0K0PX99_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A6M6AA96_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
I6LEP5_E1B19K-03          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
I6LEP5_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
J7ID56_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
T1UE63_E1B19K-02          AIKNYAKIALRPDKQYKISRRINIRNACYISGNGAEVVIDTQDKTVIRCC
T1UF50_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
T1UIP3_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCC
T1UJX4_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
T1UJX4_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKTVIRCC
A0A291P1B2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A3Q9HJZ5_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A3Q9HLF7_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A3S9SNH4_E1B19K-01      --SSQAKLVCRVKEDYKWEF----------------------------EE
A0A3S9SNY0_E1B19K-01      --SCQAKLVCRIKEDYKWEF----------------------------EE
A0A3S9SP19_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------ED
A0A3S9SSS2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A6M4W5T4_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A7D0TN91_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A7L4WGT1_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A7L4WIC2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A7L4WIG2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A7L4WK62_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A8F9W8V2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
E1ARN8_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
J7I6T8_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
J9Z4N4_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
T1UG63_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A075TSZ1_E1B19K-01      --TPLSRLVYTVKKDYKEEF----------------------------EN
A0A097I4T0_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A097I4T0_E1B19K-02      AIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A0G2UY10_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A0G2UY10_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A1J0MS84_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A291B0H2_E1B19K-01      --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A384ZUF2_E1B19K-01      --TPLSRLVYTVKKDYKEEF----------------------------EN
A0A384ZUM9_E1B19K-01      --TPLSRLVYTVKKDYKEEF----------------------------EN
A0A384ZUM9_E1B19K-02      AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
F8UFP5_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
F8UFP5_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
G3CK71_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
G3CK71_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
T1UG22_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
T1UGT5_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1UGT5_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
T1UGU0_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
T1UGX3_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCC
T1UGX3_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
T1UGY3_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
T1UHG3_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1UHG3_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
T1UHH6_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1UHH6_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
T1UHQ8_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
T1UHQ8_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1UHZ2_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1UK99_E1B19K-01          --TPLSRLVYTVKKDYQEEF----------------------------EN
T1UK99_E1B19K-02          AIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
T1UKP8_E1B19K-02          AIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEVMIDTLDKSAFRCC
T1UKQ0_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCC
T1UKQ0_E1B19K-01          --SPLSRLVYTVKKDYQEEF----------------------------EN
T1UKV6_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
T1UKV6_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
T1ULJ8_E1B19K-02          AIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEVVIDTLDKSAFRCC
T1ULJ8_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
T1ULP4_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
X4Y9D2_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A0A1EUB2_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A0A1EUC8_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A0A1EUE4_E1B19K-01      --STLSSVVYRVKKEQEGQF----------------------------SR
A0A2H5AI21_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A2H5AI40_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AI99_E1B19K-01      --STLSNVVYRVKKEQAEQF----------------------------SR
A0A2H5AID8_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A0M3TH18_E1B19K-01      --CRVSQLVVQAKVEYKEEF----------------------------EK
A0A2H4CJZ0_E1B19K-01      --STLSNVVYRVKQEYSSRF----------------------------SE
H8PFZ1_E1B19K-01          --STLSNVVYRVKQEYSSRF----------------------------SE
A0A0M3TH31_E1B19K-01      --STLSNVVHRVKREHSEEF----------------------------SR
Q6QPF3_E1B19K-01          --GPLAKLVYRAKQDYKEQF----------------------------ED
A0A9W3HRK4_E1B19K-01      --SPLSRFLYRVKREHLTEF----------------------------DG
F2WTJ7_E1B19K-01          --TSLCRLVRQVKEEYESEF----------------------------EH
A0A9W3INM3_E1B19K-01      --SPLSRFLHRVKREHLTEF----------------------------DG
H9AA76_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
H9AAD9_E1B19K-01          --STLCRVVRQVKEEYQSEF----------------------------EH
H9AAH3_E1B19K-01          --STLCRVVRQVKEEYQSEF----------------------------EH
H9AAK5_E1B19K-01          --STLCRVVRQVKEEYQSEF----------------------------EH
H9AAN8_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
M9YVA3_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
Q6QPI9_E1B19K-01          --GPLAKLVYRAKQDYKDQF----------------------------ED
Q8B6X5_E1B19K-01          --TPLSRLVRQVKLEYEKDF----------------------------ER
B5SNR1_E1B19K-01          --STLTNVIYRAKEDYSSRF----------------------------AE
A0A1L7NRH1_E1B19K-01      --SELARVVFRIKQDYKEEF----------------------------EK
Q5UW22_E1B19K-01          --SELARVVFRIKQDYKQEF----------------------------EK
J7H4R9_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
D2DM83_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
A0A7U3S224_E1B19K-01      --SELARVVFRIKQDYKEEF----------------------------EK
J7I6W7_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
J7I6W7_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCC
M0QUB4_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
C4P207_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
D4N3H6_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
M0QVK6_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
M0QVT4_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
A0A3G8WIY5_E1B19K-01      --TPLSRLVYTVKKDYKEEF----------------------------EN
T1ULP4_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
A0A7R6T9I9_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
B6C6W8_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
B9A681_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A1Y1BYF1_E1B19K-01      --TPLSRLVYTVKKDYNEEF----------------------------EN
T1UHZ2_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QU41_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A075IQ70_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
A0A075IQ70_E1B19K-02      AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCC
K7NG43_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q2KRU2_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
T1UIP3_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
A0A3S6PYX7_E1B19K-02      AIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
G1FC01_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
E5RWL1_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QU41_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
B2VQE3_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
B6DU90_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QUN2_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
E1CIM6_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
E1AI10_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
H0PPE7_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
Q9YL99_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
K7ZLN6_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
E1CIR1_E1B19K-01          --TPLSRLVYTVKKDYKEEF----------------------------EN
E1AI10_E1B19K-02          AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A384ZUF2_E1B19K-02      AIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
R4HLA0_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q2KSL3_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
A0A5J6CTQ0_E1B19K-01      --GDLARLVFRIKQDYREEF----------------------------EK
I6LES1_E1B19K-01          --GDLARLVFRIKQDYREEF----------------------------EK
Q2KSL3_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
I6LEP5_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
I6LES1_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
T1UF50_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
M0QV08_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
G9JUV5_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
M0QV08_E1B19K-02          AIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCC
T1UFS4_E1B19K-01          --SELARVVFRIKQDYKEEF----------------------------EK
T1UFS4_E1B19K-02          AIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCC
X4YVU5_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
E1CIJ0_E1B19K-01          --TPLARLVYTVKKDYQEEF----------------------------EN
T1UGU0_E1B19K-01          --TPLARLVYTVKKDYQEEF----------------------------EN
Q2KSM8_E1B19K-02          --GDLAKLVYRTKQDYKEQF----------------------------DD
A0A2R3WNP3_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
Q2KSG6_E1B19K-01          --GDLAKLVYRTKQDYKEQF----------------------------DD
Q5GFC7_E1B19K-01          --GDLAKLVYRAKQDYREQF----------------------------ED
Q5GFC8_E1B19K-01          --GDLAKLVYRAKQDYREQF----------------------------ED
Q6H1D7_E1B19K-01          --GDLAKLVYRAKQDYREQF----------------------------ED
T1UGY3_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A7U3S1T6_E1B19K-01      --SEIARVVFRIKQDYKEEF----------------------------EK
J7ID56_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
T1UKP8_E1B19K-01          --TPLSRLVYTVKKDYNEEF----------------------------EN
A0A075TSZ1_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCC
A0A897JQR0_E1B19K-01      --GDLARLVFRIKQDYSVEF----------------------------EK
I1V161_E1B19K-01          --GDLARLVFRIKQDYSVEF----------------------------EK
A0A5P8KYF0_E1B19K-01      --GDLARLVFRIKQDYSVEF----------------------------EK
J7I6S4_E1B19K-01          --GDLARLVFRIKQDYSVEF----------------------------EK
A0A897JQR0_E1B19K-02      AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
I1V161_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
A0A5P8KYF0_E1B19K-02      AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
J7I6S4_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
T1UEX7_E1B19K-01          --STLSKVVHRVKEDYREEF----------------------------EN
T1UE63_E1B19K-01          --SELARVVFRIKQDYKQEF----------------------------EK
Q6RK98_E1B19K-01          --GDLARLVFRIKQDYSVEF----------------------------EK
J7I6Q4_E1B19K-01          --GDLARLVFRIKQDYSVEF----------------------------EK
J7I6Q4_E1B19K-02          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
A0A4P2SGW2_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
E1ARN8_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A6M5E4Y6_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
P03247_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A3G8W3H5_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
E1U5L6_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A516UYI9_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
J9Z5H0_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
Q6VGV8_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A0G2R248_E1B19K-01      --SSQAKLVCRIKEDYKWEF----------------------------EE
A0A0G2R248_E1B19K-02      AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
J9Z5H0_E1B19K-02          AIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCS
A0A1P7YXN8_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
A0A1P8C849_E1B19K-02      AIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCC
T1UG22_E1B19K-01          --TPLSRLVYTVKKDYSEEF----------------------------EN
A0A2L1F392_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
A0A2R3WN16_E1B19K-01      --GDLAKLVYRTKQDYKEQF----------------------------DD
A0A2R3WN62_E1B19K-01      --GDLAKLVYRAKQDYREQF----------------------------ED
Q6H1D7_E1B19K-02          AIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCC
A0A6M6AEV2_E1B19K-01      --STLTNVIYRAKEEYSSRF----------------------------AD
A0A6M6AES6_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A9X9P8C6_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
A0A6B9DS29_E1B19K-01      --STLTNVIYRAKEDYSSRF----------------------------AE
W0S1G8_E1B19K-01          --STLTNVIYRAKEDYSSRF----------------------------AE
J9Z4H6_E1B19K-01          --SSQAKLVCRIKEDYKWEF----------------------------EE
I6LES1_E1B19K-03          AIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCC
A0A2H5AI04_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A2H5AI72_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A2H5AIL3_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
A0A0M5L3Y4_E1B19K-01      --STLSNVLYRVKKEQETQF----------------------------AR
Q5C8R2_E1B19K-01          --STLSNVLYRVKKEQETQF----------------------------AR
A0A2H5AII9_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AIN5_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AIU0_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AIL0_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AIS9_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
A0A2H5AIT6_E1B19K-01      --STLSSVVYRVKREQEAQF----------------------------AR
M9YXY5_E1B19K-01          --STLSNVVHRVKREHSEEF----------------------------SR
H9AAS0_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
H9AAV3_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
H9AAY5_E1B19K-01          --TSLCRLVRQVKEEYQSEF----------------------------EH
                                                                            

Q7T8D8_E1B19K-03          ---------------------------TL-SSSPL---------------
Q6RK98_E1B19K-03          ---------------------------TL-SSSPL---------------
P04492_E1B19K-02          MQGMGPG-VVGL---------DGITFINVRFAGDKFKGIMFEANTCLVLH
Q2KSM8_E1B19K-01          ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
M9YVF6_E1B19K-01          LVADVPG-LFVSLDLGHHSYFQEKIVKGLVFESTG---------------
T2CI10_E1B19K-01          LLDDCPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A1W5PVU4_E1B19K-01      LFSEVPG-LVDSLNFCHHAFFYEKVICGLDFCTPG---------------
A0A3Q9HK00_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A9X9PKC1_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A5K6WAR5_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
T2CI10_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNVKFRGDGYNGVVFMANTKLILH
A0A2H5AIC5_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A0M4N3Z1_E1B19K-01      ILDQCPG-VFESLELGYHKVFEDKIVKELDFSSPG---------------
A0A3S9SPV1_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A9W3HRK4_E1B19K-02      MQEMCPG-VVGL---------SGVTFHSVRFSGSNFGGVVITANTPVVLH
A0A7L4WJT1_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
D3JIR7_E1B19K-02          MQGMGPG-VVGL---------GGITFINVRFAGDKFKGTLFEANTSLVLH
Q2KSM8_E1B19K-03          MMNMYPG-VVDM---------DGVTFMNIRFRGDGYNGTVFMANTKLTVH
A0A7U3RVU4_E1B19K-01      LLSHNPG-IFASLNLGHHSFFQEIVIRNLDFSSPG---------------
F2WTM9_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
A0A0M4NHE0_E1B19K-01      ILSNCPG-LFVSLDLGHHTVFQEKIVKALDFSSPG---------------
A0A2H4PJ75_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
G0ZAH2_E1B19K-01          LLQEQNRLLLNNLELGHTRALN-GVLRELDFENTG---------------
P10406_E1B19K-01          ILRECPS-LFDALNLGHQSHFNQRISRALDFTTPG---------------
M0QU02_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
J9Z4H6_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
P04492_E1B19K-01          ILADCPG-LLASLDLCYHLVFQEKVVRSLDFSSVG---------------
A0A898KBW7_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A7L4WG90_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3S9SND6_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
J7I6T8_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
A0A5H2QAX5_E1B19K-01      ILADCPG-LLASLDLCHHSVFQERVVRSLDFSSSG---------------
Q6QPB7_E1B19K-01          ILRECPG-IFDSLNLGHQSHFNQSILRALDFSTPG---------------
A0A8G1GLF6_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
T1UG63_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
A0A3Q9HJ63_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
T1UEX7_E1B19K-02          MQGMGPG-VVGL---------DGITFMNVRFAGEKFKGIMFEANTSVVLH
F6KST6_E1B19K-01          LLEHLPG-LFDSLNLGHRVLLEERLFPQLDFSSPG---------------
A0A482EVC6_E1B19K-02      MQSLGPG-VIGM---------SGVTFNNVRFAADGFNGKVFASTTQLTLH
A0A3Q9HK78_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
H9AAA8_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
A0MK43_E1B19K-02          MQSLGPG-VIGL---------NGVTFQNVRFTGDNFNGSVFVTSTQLTLH
Q32UI6_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
A0A3S6PYX7_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
Q5GFC7_E1B19K-03          MMNMYPG-VVDM---------DGVTFMNMRFRGDGYNGTVFMANTKLTVH
A0A3Q9HJ54_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A898KBR0_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
J9Z4N4_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
P10544_E1B19K-01          LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
F4ZCJ8_E1B19K-01          LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
Q8UY91_E1B19K-01          ILRECSG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A9W3I4N3_E1B19K-01      LLEQLPG-LFDSLNLGHRTLLEERLFPQLDFSSPG---------------
A0A1L3INW0_E1B19K-01      LIGLFPT-IFESLNLGHKTLLEDKLLVQLDFSTPG---------------
A0A097IW62_E1B19K-01      LFAEVPG-LLESLNFCHHAVFYEKIICSLDFCTPG---------------
A0A3G4W995_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A7D0TLU2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
G9G841_E1B19K-01          ILRECPG-LFDALNLGHQTHFNQRIVRALDFTTPG---------------
Q6VGV8_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
P06501_E1B19K-01          ILDQCPG-VFESLELGYHKVFEEKIVKELDFSSPG---------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
W6EIX6_E1B19K-01          LLLDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
W6EIX6_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
Q7T8D8_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
Q7T8D8_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
Q8B8U7_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
Q32UI6_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
B9A5Q1_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B9A5T7_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QU76_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QU76_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A0B4SJH1_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A0B4SJH1_E1B19K-02      MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
Q2KS85_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2KS85_E1B19K-02          MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
C5HDR2_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
C5HDR2_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
D3GBW3_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QUB4_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
W8CZB0_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
W8CZB0_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMTNSHMTLH
M0QUF3_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QUF3_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVMFMANSHMTLH
M0QUJ3_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QUJ3_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVMFMANSHMTLH
M0QUN2_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
C4P207_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
R4HLJ6_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
R4HLJ6_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
M0QTS5_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
M0QTS5_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
M0QUS9_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
M0QUS9_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
Q3ZL02_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
Q3ZL02_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
M0QV47_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
M0QV47_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
M0QV87_E1B19K-01          LFSDCSG-LLDSLNFGHQSLFQERVLHSLDFSTPG---------------
M0QV87_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTVH
M0QVC7_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QVC7_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
M0QVG6_E1B19K-01          LFVDCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
M0QVG6_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
M0QVK6_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
M0QVP5_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
M0QVP5_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
Q4KSL0_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QUW8_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
M0QUW8_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
A0A3G9JTX5_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A3G9K5X3_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A3G9CMQ4_E1B19K-01      ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q3ZKW2_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q3ZKW2_E1B19K-02          MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
M0QVT4_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0MK43_E1B19K-01          LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A3Q9FFS0_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A3Q9FFS0_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
E5RWD9_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B9A5L5_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A7G5F9T0_E1B19K-01      LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
A0A7G5FB98_E1B19K-01      LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
A0A7G5FB98_E1B19K-02      MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
C7SRS7_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
A0A1Y1BXT7_E1B19K-01      IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E9P585_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E9P585_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
G1FC01_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVMFMANSHMTLH
G1DE13_E1B19K-01          ILTDCPG-LLASLDLCHHSVFQERVVRSLDFSSSG---------------
G1FBW4_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
G1FBW4_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
R4HLA0_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
H5T740_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
K7NG43_E1B19K-02          MMGMWPG-VVGM---------EAVTFMNIRFRGDGYNGIVFMANTKLILH
T1UHL7_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1UHL7_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
R4HMC6_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
R4HMC6_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
W8VNG2_E1B19K-01          LFSDCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A3G8WH01_E1B19K-01      ILADCPG-LLASLDLCHHLVFQEKVVRSLDFSSVG---------------
D3JIR7_E1B19K-01          ILAGCPG-LLASLDLCHHSIFQEKVVKSLDFSSAG---------------
A0A5H2QAX5_E1B19K-02      MQGMGPG-VVGL---------DGITFMNVRFAGEKFKGIMFEANTSVVLH
D0Z5R9_E1B19K-01          ILADCPG-LLASLDLCHHSVFQERVVRSLDFSSSG---------------
Q2KRU2_E1B19K-02          MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
R4HLE1_E1B19K-01          LLDNSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
R4HLE1_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
Q7T951_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
A0A8B0L9Y2_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A8B0LBX6_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A8B0LCV0_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A8B0LD36_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2Y0J3_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2Y0J3_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFKGDGYNGIVFMANTKLILH
A0A220VZ73_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
P03248_E1B19K-03          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
P03248_E1B19K-02          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q5EY83_E1B19K-01          LLDDIPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q5EY83_E1B19K-02          MMGMWPG-VVGM---------EAITLMNIRFRGDGYNGIVFMANTKLILH
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
A0A7D6TSN5_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A1U9ALK7_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A4P2SGW2_E1B19K-02      MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
P03246_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
Q6WQ37_E1B19K-01          LLKSCGE-LFDSLNLGHQALLQEKVIKTLDFSTPG---------------
E1U5L6_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
F1DT57_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A1P7YWR9_E1B19K-01      IFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A1P7YWR9_E1B19K-02      MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
A0A1P7YWY2_E1B19K-02      MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
A0A1P7YWY2_E1B19K-01      IFADCSC-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A1P7YXN8_E1B19K-01      IFADCSC-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A1P7YYY5_E1B19K-02      MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
A0A1P7YYY5_E1B19K-01      LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A1P8C849_E1B19K-01      LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
B9A5A7_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
M0QU02_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A3G8W6L2_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q2KSG6_E1B19K-02          ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          MMNMYPG-VVDM---------DGVTFMNIRFRGDGYNGTV-MANTKLTVH
Q5GFC7_E1B19K-02          ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A142G3J2_E1B19K-01      LLSHNPG-IFASLNLGHHSFFQEIVIRNLDFSSPG---------------
P10543_E1B19K-01          LLSHNPG-IFASLNLGHHSFFQEIVIRNLDFSSPG---------------
A0A1S6ELT2_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A3G8W407_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A482EVC6_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A7U3RWV6_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A898KBS1_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A513TZR1_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A516UYM9_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A0K0PX35_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A0K0PX99_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A6M6AA96_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
I6LEP5_E1B19K-03          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
I6LEP5_E1B19K-01          LLDDSPG-LFEALNLGHRAHFKEKVLSVLDFSTPG---------------
J7ID56_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
T1UE63_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
T1UF50_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
T1UIP3_E1B19K-02          MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
T1UJX4_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
T1UJX4_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
A0A291P1B2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3Q9HJZ5_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3Q9HLF7_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3S9SNH4_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3S9SNY0_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3S9SP19_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3S9SSS2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A6M4W5T4_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A7D0TN91_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A7L4WGT1_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A7L4WIC2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A7L4WIG2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A7L4WK62_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A8F9W8V2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
E1ARN8_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
J7I6T8_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
J9Z4N4_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
T1UG63_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A075TSZ1_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A097I4T0_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A097I4T0_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A0G2UY10_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A0G2UY10_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVMFMANSHMTLH
A0A1J0MS84_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A291B0H2_E1B19K-01      LFSDCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A384ZUF2_E1B19K-01      IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A384ZUM9_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A384ZUM9_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
F8UFP5_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
F8UFP5_E1B19K-01          LFSDCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
G3CK71_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVMFMANSHMTLH
G3CK71_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
T1UG22_E1B19K-02          MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
T1UGT5_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UGT5_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
T1UGU0_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
T1UGX3_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UGX3_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
T1UGY3_E1B19K-02          MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
T1UHG3_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UHG3_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1UHH6_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UHH6_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1UHQ8_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1UHQ8_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UHZ2_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UK99_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
T1UK99_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UKP8_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTVH
T1UKQ0_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
T1UKQ0_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
T1UKV6_E1B19K-01          LFSDCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
T1UKV6_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNIKFNGEKFNGVLFMANSHMTLH
T1ULJ8_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1ULJ8_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
T1ULP4_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
X4Y9D2_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A0A1EUB2_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A0A1EUC8_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A0A1EUE4_E1B19K-01      LLADIPG-VFVALDLGHHSLFQEKIVKSLTFSSPG---------------
A0A2H5AI21_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A2H5AI40_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AI99_E1B19K-01      LLAEIPG-VFVALDLGHHALFQEKVIKSLTFSSPG---------------
A0A2H5AID8_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A0M3TH18_E1B19K-01      LFSEVPG-LVDSLNFCHHAFFYEKVICGLDFCTPG---------------
A0A2H4CJZ0_E1B19K-01      LLARYPA-VFASLDLGHHVYFQEAVVRYLDFSTPG---------------
H8PFZ1_E1B19K-01          LLARYPA-VFVSLDLGHHVYFQEAVVRYLDFSTPG---------------
A0A0M3TH31_E1B19K-01      LVADVPG-LFVSLDLGHHSYFQEKIVKGLVFESTG---------------
Q6QPF3_E1B19K-01          ILRECPG-IFDSLNLGHQSHFNQSILRALDFSTPG---------------
A0A9W3HRK4_E1B19K-01      LLEQLPG-LFDSLNLGHRTLLEERLFPQLDFSSPG---------------
F2WTJ7_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
A0A9W3INM3_E1B19K-01      LLEQLPG-LFDSLNLGHRTLLEERLFPQLDFSSPG---------------
H9AA76_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
H9AAD9_E1B19K-01          ILSNCPG-LFVSLDLGHHTVFQEKIVKALDFSSPG---------------
H9AAH3_E1B19K-01          ILSNCPG-LFVSLDLGHHTVFQEKIVKALDFSSPG---------------
H9AAK5_E1B19K-01          ILSNCPG-LFVSLDLGHHTVFQEKIVKALDFSSPG---------------
H9AAN8_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
M9YVA3_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
Q6QPI9_E1B19K-01          ILRECPG-IFDSLNLGHQSHFNQSILRALDFSTPG---------------
Q8B6X5_E1B19K-01          ILDQCPG-VFESLELGYHKVFEDKIVKELDFSSPG---------------
B5SNR1_E1B19K-01          LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A1L7NRH1_E1B19K-01      LLLDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
Q5UW22_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
J7H4R9_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
D2DM83_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
A0A7U3S224_E1B19K-01      LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
J7I6W7_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
J7I6W7_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
M0QUB4_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
C4P207_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
D4N3H6_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QVK6_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QVT4_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A3G8WIY5_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1ULP4_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A7R6T9I9_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B6C6W8_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B9A681_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A1Y1BYF1_E1B19K-01      LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
T1UHZ2_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QU41_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A075IQ70_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A075IQ70_E1B19K-02      MMGMWPG-VVGM---------EAVTFMNIRFKGDGYNGIVFMANTKLILH
K7NG43_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2KRU2_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
T1UIP3_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A3S6PYX7_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
G1FC01_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
E5RWL1_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QU41_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B2VQE3_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
B6DU90_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
M0QUN2_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E1CIM6_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E1AI10_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
H0PPE7_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
Q9YL99_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
K7ZLN6_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E1CIR1_E1B19K-01          IFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
E1AI10_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A384ZUF2_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
R4HLA0_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2KSL3_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A5J6CTQ0_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
I6LES1_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
Q2KSL3_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
I6LEP5_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
I6LES1_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
T1UF50_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
M0QV08_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
G9JUV5_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
M0QV08_E1B19K-02          MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
T1UFS4_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
T1UFS4_E1B19K-02          MMDMWPG-VVGM---------EAVTFVNVKFRGDGYNGIVFMANTKLILH
X4YVU5_E1B19K-01          LFVDCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
E1CIJ0_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
T1UGU0_E1B19K-01          LFADCSG-LLDSLNLGHQALFQERVLHSLDFSSPG---------------
Q2KSM8_E1B19K-02          ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A2R3WNP3_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q2KSG6_E1B19K-01          ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q5GFC7_E1B19K-01          ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q5GFC8_E1B19K-01          ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q6H1D7_E1B19K-01          ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
T1UGY3_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A7U3S1T6_E1B19K-01      LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
J7ID56_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
T1UKP8_E1B19K-01          LFADCSG-LLDSLNLGHQSLFQERVLHSLDFSSPG---------------
A0A075TSZ1_E1B19K-02      MMGMRAG-VMNM---------NSMIFMNMKFNGEKFNGVLFMANSHMTLH
A0A897JQR0_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
I1V161_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A5P8KYF0_E1B19K-01      LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
J7I6S4_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
A0A897JQR0_E1B19K-02      MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
I1V161_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
A0A5P8KYF0_E1B19K-02      MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
J7I6S4_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
T1UEX7_E1B19K-01          ILADCPG-LLASLDLCHHSVFQERVVRSLDFSSSG---------------
T1UE63_E1B19K-01          LLVDCPG-LFEALNLGHQVHFKEKVLSVLDFSTPG---------------
Q6RK98_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
J7I6Q4_E1B19K-01          LLDDSPG-LFEALNLGHQAHFKEKVLSVLDFSTPG---------------
J7I6Q4_E1B19K-02          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
A0A4P2SGW2_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
E1ARN8_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A6M5E4Y6_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
P03247_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A3G8W3H5_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
E1U5L6_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A516UYI9_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
J9Z5H0_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
Q6VGV8_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A0G2R248_E1B19K-01      LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
A0A0G2R248_E1B19K-02      MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
J9Z5H0_E1B19K-02          MINMWPG-VLGM---------DGVVIMNVRFTGPNFSGTVFLANTNLILH
A0A1P7YXN8_E1B19K-02      MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
A0A1P8C849_E1B19K-02      MMGMRAG-VMNM---------NSMIFINIKFNGEKFNGVLFMANSHMTLH
T1UG22_E1B19K-01          LFADCSG-LLDSLNFGHQSLFQERVLHSLDFSSPG---------------
A0A2L1F392_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A2R3WN16_E1B19K-01      ILKECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
A0A2R3WN62_E1B19K-01      ILRECPG-LFDALNLGHQSHFNQRISRALDFTTPG---------------
Q6H1D7_E1B19K-02          MMNMYPG-VVDM---------DGVTFMNMRFRGDGYNGTVFMANTKLTVH
A0A6M6AEV2_E1B19K-01      LLSHNPG-IFASLNLGHHSFFQEIVIRNLDFSSPG---------------
A0A6M6AES6_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A9X9P8C6_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
A0A6B9DS29_E1B19K-01      LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
W0S1G8_E1B19K-01          LLSFNPG-IFASLNLGHHSFFQEIVIKNLDFSSPG---------------
J9Z4H6_E1B19K-01          LLKSCGE-LFDSLNLGHQALFQEKVIKTLDFSTPG---------------
I6LES1_E1B19K-03          MMGMWPG-VVGM---------EAVTLMNIRFRGDGYNGIVFMANTKLILH
A0A2H5AI04_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A2H5AI72_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A2H5AIL3_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A0M5L3Y4_E1B19K-01      LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
Q5C8R2_E1B19K-01          LLADTPG-VFVALDLGHHSLFQEKIIKNLTFTSPG---------------
A0A2H5AII9_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AIN5_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AIU0_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AIL0_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AIS9_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
A0A2H5AIT6_E1B19K-01      LLAETPG-VLVALDLGHHSLFQEKIIRNLTFSSPG---------------
M9YXY5_E1B19K-01          LVADVPG-LFVSLDLGHHSYFQEKIVKGLVFESTG---------------
H9AAS0_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
H9AAV3_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
H9AAY5_E1B19K-01          ILSTCQG-LFESLELGHHTVFQEKIVKALDFSSPG---------------
                                                                            

Q7T8D8_E1B19K-03          ----------------------------------DAAA------------
Q6RK98_E1B19K-03          ----------------------------------DAAA------------
P04492_E1B19K-02          GVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKC
Q2KSM8_E1B19K-01          ----------------------------------RTTA------------
M9YVF6_E1B19K-01          ----------------------------------RTVV------------
T2CI10_E1B19K-01          ----------------------------------RTAA------------
A0A1W5PVU4_E1B19K-01      ----------------------------------RTIA------------
A0A3Q9HK00_E1B19K-01      ----------------------------------RAAA------------
A0A9X9PKC1_E1B19K-01      ----------------------------------RTVS------------
A0A5K6WAR5_E1B19K-01      ----------------------------------RAAA------------
T2CI10_E1B19K-02          GCSFFGFNNICVEAWGQVSVRGCSFYACWIATSGRTKSQLSVKKCMFERC
A0A2H5AIC5_E1B19K-01      ----------------------------------RTVA------------
A0A0M4N3Z1_E1B19K-01      ----------------------------------RAVA------------
A0A3S9SPV1_E1B19K-01      ----------------------------------RAAA------------
A0A9W3HRK4_E1B19K-02      NCYFFGFSNTCVEMRVGGKVRGCSFYACWKGVVSQGKAKVSVHKCMLERC
A0A7L4WJT1_E1B19K-01      ----------------------------------RAAA------------
D3JIR7_E1B19K-02          GVYFLNFSNTCVESWIKVSARGCTFYGCRRGLVGRPKSKMSVKKCLFEKC
Q2KSM8_E1B19K-03          GCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERC
A0A7U3RVU4_E1B19K-01      ----------------------------------RTVS------------
F2WTM9_E1B19K-01          ----------------------------------RAVA------------
A0A0M4NHE0_E1B19K-01      ----------------------------------RAVA------------
A0A2H4PJ75_E1B19K-01      ----------------------------------RAAA------------
G0ZAH2_E1B19K-01          ----------------------------------RVVA------------
P10406_E1B19K-01          ----------------------------------RTTA------------
M0QU02_E1B19K-02          GCKFFGFNNMCAEVWGSAKIRGCVYYGCWMGVVGRPKSEMSVKQCVFEKC
J9Z4H6_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
P04492_E1B19K-01          ----------------------------------RTVA------------
A0A898KBW7_E1B19K-01      ----------------------------------RAVS------------
A0A7L4WG90_E1B19K-01      ----------------------------------RAAA------------
A0A3S9SND6_E1B19K-01      ----------------------------------RAAA------------
J7I6T8_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
A0A5H2QAX5_E1B19K-01      ----------------------------------RTVA------------
Q6QPB7_E1B19K-01          ----------------------------------RTTA------------
A0A8G1GLF6_E1B19K-01      ----------------------------------RTVS------------
T1UG63_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
A0A3Q9HJ63_E1B19K-01      ----------------------------------RAAA------------
T1UEX7_E1B19K-02          GVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKC
F6KST6_E1B19K-01          ----------------------------------RLCS------------
A0A482EVC6_E1B19K-02      GVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERC
A0A3Q9HK78_E1B19K-01      ----------------------------------RAAA------------
H9AAA8_E1B19K-01          ----------------------------------RAVA------------
A0MK43_E1B19K-02          GVYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKKCIFERC
Q32UI6_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
A0A3S6PYX7_E1B19K-01      ----------------------------------RTTA------------
Q5GFC7_E1B19K-03          GCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERC
A0A3Q9HJ54_E1B19K-01      ----------------------------------RAAA------------
A0A898KBR0_E1B19K-01      ----------------------------------RTVS------------
J9Z4N4_E1B19K-01          ----------------------------------RAAA------------
P10544_E1B19K-01          ----------------------------------RTVS------------
F4ZCJ8_E1B19K-01          ----------------------------------RTVS------------
Q8UY91_E1B19K-01          ----------------------------------RTTA------------
A0A9W3I4N3_E1B19K-01      ----------------------------------RLCS------------
A0A1L3INW0_E1B19K-01      ----------------------------------RACS------------
A0A097IW62_E1B19K-01      ----------------------------------RTIA------------
A0A3G4W995_E1B19K-01      ----------------------------------RTVS------------
A0A7D0TLU2_E1B19K-01      ----------------------------------RAAA------------
G9G841_E1B19K-01          ----------------------------------RSTA------------
Q6VGV8_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
P06501_E1B19K-01          ----------------------------------RAVA------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ----------------------------------RAVA------------
W6EIX6_E1B19K-01          ----------------------------------RTAA------------
W6EIX6_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFCACWIATAGRTKSQLSLKKCIFQRC
Q7T8D8_E1B19K-01          ----------------------------------RTAA------------
Q7T8D8_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
Q8B8U7_E1B19K-01          ----------------------------------RTAA------------
Q32UI6_E1B19K-01          ----------------------------------RTAA------------
B9A5Q1_E1B19K-01          ----------------------------------RTTA------------
B9A5T7_E1B19K-01          ----------------------------------RTTA------------
M0QU76_E1B19K-01          ----------------------------------RTTA------------
M0QU76_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A0B4SJH1_E1B19K-01      ----------------------------------RTAA------------
A0A0B4SJH1_E1B19K-02      GCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
Q2KS85_E1B19K-01          ----------------------------------RTAA------------
Q2KS85_E1B19K-02          GCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERC
C5HDR2_E1B19K-01          ----------------------------------RTTA------------
C5HDR2_E1B19K-02          GCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
D3GBW3_E1B19K-01          ----------------------------------RTTA------------
M0QUB4_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
W8CZB0_E1B19K-01          ----------------------------------RTTA------------
W8CZB0_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QUF3_E1B19K-01          ----------------------------------RTTA------------
M0QUF3_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QUJ3_E1B19K-01          ----------------------------------RTTA------------
M0QUJ3_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QUN2_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
C4P207_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
R4HLJ6_E1B19K-01          ----------------------------------RTAA------------
R4HLJ6_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
M0QTS5_E1B19K-01          ----------------------------------RTTA------------
M0QTS5_E1B19K-02          GCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QUS9_E1B19K-01          ----------------------------------RTTA------------
M0QUS9_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
Q3ZL02_E1B19K-01          ----------------------------------RTAA------------
Q3ZL02_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
M0QV47_E1B19K-01          ----------------------------------RTTA------------
M0QV47_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QV87_E1B19K-01          ----------------------------------RTTA------------
M0QV87_E1B19K-02          GCSFFGFNNMCAEIWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QVC7_E1B19K-01          ----------------------------------RTTA------------
M0QVC7_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QVG6_E1B19K-01          ----------------------------------RTTA------------
M0QVG6_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QVK6_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
M0QVP5_E1B19K-01          ----------------------------------RTTA------------
M0QVP5_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKC
Q4KSL0_E1B19K-01          ----------------------------------RTTA------------
M0QUW8_E1B19K-01          ----------------------------------RTTA------------
M0QUW8_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A3G9JTX5_E1B19K-01      ----------------------------------RTTA------------
A0A3G9K5X3_E1B19K-01      ----------------------------------RTTA------------
A0A3G9CMQ4_E1B19K-01      ----------------------------------RTTA------------
Q3ZKW2_E1B19K-01          ----------------------------------RTAA------------
Q3ZKW2_E1B19K-02          GCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERC
M0QVT4_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0MK43_E1B19K-01          ----------------------------------RTVA------------
A0A3Q9FFS0_E1B19K-01      ----------------------------------RTTA------------
A0A3Q9FFS0_E1B19K-02      GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
E5RWD9_E1B19K-01          ----------------------------------RTTA------------
B9A5L5_E1B19K-01          ----------------------------------RTTA------------
A0A7G5F9T0_E1B19K-01      ----------------------------------RTAA------------
A0A7G5FB98_E1B19K-01      ----------------------------------RTAA------------
A0A7G5FB98_E1B19K-02      GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
C7SRS7_E1B19K-01          ----------------------------------RTAA------------
A0A1Y1BXT7_E1B19K-01      ----------------------------------RTTA------------
E9P585_E1B19K-01          ----------------------------------RTTA------------
E9P585_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
G1FC01_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
G1DE13_E1B19K-01          ----------------------------------RTVA------------
G1FBW4_E1B19K-01          ----------------------------------RTTA------------
G1FBW4_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKC
R4HLA0_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
H5T740_E1B19K-01          ----------------------------------RTTA------------
K7NG43_E1B19K-02          GCSFFGVNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSAKKCMFERC
T1UHL7_E1B19K-01          ----------------------------------RTTA------------
T1UHL7_E1B19K-02          GCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
R4HMC6_E1B19K-01          ----------------------------------RTAA------------
R4HMC6_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
W8VNG2_E1B19K-01          ----------------------------------RTTA------------
A0A3G8WH01_E1B19K-01      ----------------------------------RTVA------------
D3JIR7_E1B19K-01          ----------------------------------RTVA------------
A0A5H2QAX5_E1B19K-02      GVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKC
D0Z5R9_E1B19K-01          ----------------------------------RTVA------------
Q2KRU2_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
R4HLE1_E1B19K-01          ----------------------------------RTAA------------
R4HLE1_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
Q7T951_E1B19K-01          ----------------------------------RTAA------------
A0A8B0L9Y2_E1B19K-01      ----------------------------------RTAA------------
A0A8B0LBX6_E1B19K-01      ----------------------------------RTAA------------
A0A8B0LCV0_E1B19K-01      ----------------------------------RTAA------------
A0A8B0LD36_E1B19K-01      ----------------------------------RTAA------------
Q2Y0J3_E1B19K-01          ----------------------------------RTAA------------
Q2Y0J3_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
A0A220VZ73_E1B19K-01      ----------------------------------RTAA------------
P03248_E1B19K-03          GCRFFGFNNTCEEA------------------------------------
P03248_E1B19K-02          ----------------------------------RTAA------------
Q5EY83_E1B19K-01          ----------------------------------RTAA------------
Q5EY83_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
A0A7D6TSN5_E1B19K-01      ----------------------------------RAAA------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          ----------------------------------RAAA------------
A0A1U9ALK7_E1B19K-01      ----------------------------------RAAA------------
A0A4P2SGW2_E1B19K-02      GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
P03246_E1B19K-01          ----------------------------------RAAA------------
Q6WQ37_E1B19K-01          ----------------------------------RAAA------------
E1U5L6_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          ----------------------------------RTTA------------
F1DT57_E1B19K-02          GCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1P7YWR9_E1B19K-01      ----------------------------------RTTA------------
A0A1P7YWR9_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1P7YWY2_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1P7YWY2_E1B19K-01      ----------------------------------RTTA------------
A0A1P7YXN8_E1B19K-01      ----------------------------------RTTA------------
A0A1P7YYY5_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1P7YYY5_E1B19K-01      ----------------------------------RTTA------------
A0A1P8C849_E1B19K-01      ----------------------------------RTTA------------
B9A5A7_E1B19K-01          ----------------------------------RTTA------------
M0QU02_E1B19K-01          ----------------------------------RTTA------------
A0A3G8W6L2_E1B19K-01      ----------------------------------RTTA------------
Q2KSG6_E1B19K-02          ----------------------------------RTTA------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          GCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERC
Q5GFC7_E1B19K-02          ----------------------------------RTTA------------
A0A142G3J2_E1B19K-01      ----------------------------------RTVS------------
P10543_E1B19K-01          ----------------------------------RTVS------------
A0A1S6ELT2_E1B19K-01      ----------------------------------RTVS------------
A0A3G8W407_E1B19K-01      ----------------------------------RTVS------------
A0A482EVC6_E1B19K-01      ----------------------------------RTVS------------
A0A7U3RWV6_E1B19K-01      ----------------------------------RTVS------------
A0A898KBS1_E1B19K-01      ----------------------------------RTVS------------
A0A513TZR1_E1B19K-01      ----------------------------------RAAA------------
A0A516UYM9_E1B19K-01      ----------------------------------RAAA------------
A0A0K0PX35_E1B19K-01      ----------------------------------RTAA------------
A0A0K0PX99_E1B19K-01      ----------------------------------RTAA------------
A0A6M6AA96_E1B19K-01      ----------------------------------RTAA------------
I6LEP5_E1B19K-03          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
I6LEP5_E1B19K-01          ----------------------------------RTAA------------
J7ID56_E1B19K-01          ----------------------------------RTAA------------
T1UE63_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
T1UF50_E1B19K-01          ----------------------------------RTAA------------
T1UIP3_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
T1UJX4_E1B19K-01          ----------------------------------RTAA------------
T1UJX4_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
A0A291P1B2_E1B19K-01      ----------------------------------RAAA------------
A0A3Q9HJZ5_E1B19K-01      ----------------------------------RVAA------------
A0A3Q9HLF7_E1B19K-01      ----------------------------------RAAA------------
A0A3S9SNH4_E1B19K-01      ----------------------------------RAAA------------
A0A3S9SNY0_E1B19K-01      ----------------------------------RAAA------------
A0A3S9SP19_E1B19K-01      ----------------------------------RAAA------------
A0A3S9SSS2_E1B19K-01      ----------------------------------RAAA------------
A0A6M4W5T4_E1B19K-01      ----------------------------------RAAA------------
A0A7D0TN91_E1B19K-01      ----------------------------------RAAA------------
A0A7L4WGT1_E1B19K-01      ----------------------------------RAAA------------
A0A7L4WIC2_E1B19K-01      ----------------------------------RAAA------------
A0A7L4WIG2_E1B19K-01      ----------------------------------RAAA------------
A0A7L4WK62_E1B19K-01      ----------------------------------RAAA------------
A0A8F9W8V2_E1B19K-01      ----------------------------------RAAA------------
E1ARN8_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
J7I6T8_E1B19K-01          ----------------------------------RAAA------------
J9Z4N4_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
T1UG63_E1B19K-01          ----------------------------------RTAA------------
A0A075TSZ1_E1B19K-01      ----------------------------------RTTA------------
A0A097I4T0_E1B19K-01      ----------------------------------RTTA------------
A0A097I4T0_E1B19K-02      GCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A0G2UY10_E1B19K-01      ----------------------------------RTTA------------
A0A0G2UY10_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1J0MS84_E1B19K-01      ----------------------------------RTTA------------
A0A291B0H2_E1B19K-01      ----------------------------------RTTA------------
A0A384ZUF2_E1B19K-01      ----------------------------------RTTA------------
A0A384ZUM9_E1B19K-01      ----------------------------------RTTA------------
A0A384ZUM9_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
F8UFP5_E1B19K-02          GCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
F8UFP5_E1B19K-01          ----------------------------------RTTA------------
G3CK71_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
G3CK71_E1B19K-01          ----------------------------------RTTA------------
T1UG22_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UGT5_E1B19K-02          GCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UGT5_E1B19K-01          ----------------------------------RTTA------------
T1UGU0_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UGX3_E1B19K-02          GCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UGX3_E1B19K-01          ----------------------------------RTTA------------
T1UGY3_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UHG3_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UHG3_E1B19K-01          ----------------------------------RTTA------------
T1UHH6_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UHH6_E1B19K-01          ----------------------------------RTTA------------
T1UHQ8_E1B19K-01          ----------------------------------RTTA------------
T1UHQ8_E1B19K-02          GCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UHZ2_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UK99_E1B19K-01          ----------------------------------RTTA------------
T1UK99_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UKP8_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UKQ0_E1B19K-02          GCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UKQ0_E1B19K-01          ----------------------------------RTTA------------
T1UKV6_E1B19K-01          ----------------------------------RTTA------------
T1UKV6_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1ULJ8_E1B19K-02          GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1ULJ8_E1B19K-01          ----------------------------------RTTA------------
T1ULP4_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
X4Y9D2_E1B19K-01          ----------------------------------RTTA------------
A0A0A1EUB2_E1B19K-01      ----------------------------------RTVA------------
A0A0A1EUC8_E1B19K-01      ----------------------------------RTVA------------
A0A0A1EUE4_E1B19K-01      ----------------------------------RTVV------------
A0A2H5AI21_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AI40_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AI99_E1B19K-01      ----------------------------------RVVT------------
A0A2H5AID8_E1B19K-01      ----------------------------------RTVA------------
A0A0M3TH18_E1B19K-01      ----------------------------------RTIA------------
A0A2H4CJZ0_E1B19K-01      ----------------------------------RTVS------------
H8PFZ1_E1B19K-01          ----------------------------------RAVS------------
A0A0M3TH31_E1B19K-01      ----------------------------------RTVV------------
Q6QPF3_E1B19K-01          ----------------------------------RTTA------------
A0A9W3HRK4_E1B19K-01      ----------------------------------RLCS------------
F2WTJ7_E1B19K-01          ----------------------------------RAVA------------
A0A9W3INM3_E1B19K-01      ----------------------------------RLCS------------
H9AA76_E1B19K-01          ----------------------------------RAVA------------
H9AAD9_E1B19K-01          ----------------------------------RAVA------------
H9AAH3_E1B19K-01          ----------------------------------RAVA------------
H9AAK5_E1B19K-01          ----------------------------------RAVA------------
H9AAN8_E1B19K-01          ----------------------------------RAVA------------
M9YVA3_E1B19K-01          ----------------------------------RAVA------------
Q6QPI9_E1B19K-01          ----------------------------------RTTA------------
Q8B6X5_E1B19K-01          ----------------------------------RAVA------------
B5SNR1_E1B19K-01          ----------------------------------RTVS------------
A0A1L7NRH1_E1B19K-01      ----------------------------------RTAA------------
Q5UW22_E1B19K-01          ----------------------------------RTAA------------
J7H4R9_E1B19K-01          ----------------------------------RTAA------------
D2DM83_E1B19K-01          ----------------------------------RTAA------------
A0A7U3S224_E1B19K-01      ----------------------------------RTAA------------
J7I6W7_E1B19K-01          ----------------------------------RTAA------------
J7I6W7_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
M0QUB4_E1B19K-01          ----------------------------------RTTA------------
C4P207_E1B19K-01          ----------------------------------RTTA------------
D4N3H6_E1B19K-01          ----------------------------------RTTA------------
M0QVK6_E1B19K-01          ----------------------------------RTTA------------
M0QVT4_E1B19K-01          ----------------------------------RTTA------------
A0A3G8WIY5_E1B19K-01      ----------------------------------RTTA------------
T1ULP4_E1B19K-01          ----------------------------------RTTA------------
A0A7R6T9I9_E1B19K-01      ----------------------------------RTTA------------
B6C6W8_E1B19K-01          ----------------------------------RTTA------------
B9A681_E1B19K-01          ----------------------------------RTTA------------
A0A1Y1BYF1_E1B19K-01      ----------------------------------RTTA------------
T1UHZ2_E1B19K-01          ----------------------------------RTTA------------
M0QU41_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A075IQ70_E1B19K-01      ----------------------------------RTAA------------
A0A075IQ70_E1B19K-02      GCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
K7NG43_E1B19K-01          ----------------------------------RTAA------------
Q2KRU2_E1B19K-01          ----------------------------------RTAA------------
T1UIP3_E1B19K-01          ----------------------------------RTAA------------
A0A3S6PYX7_E1B19K-02      GCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
G1FC01_E1B19K-01          ----------------------------------RTTA------------
E5RWL1_E1B19K-01          ----------------------------------RTTA------------
M0QU41_E1B19K-01          ----------------------------------RTTA------------
B2VQE3_E1B19K-01          ----------------------------------RTTA------------
B6DU90_E1B19K-01          ----------------------------------RTTA------------
M0QUN2_E1B19K-01          ----------------------------------RTTA------------
E1CIM6_E1B19K-01          ----------------------------------RTTA------------
E1AI10_E1B19K-01          ----------------------------------RTTA------------
H0PPE7_E1B19K-01          ----------------------------------RTTA------------
Q9YL99_E1B19K-01          ----------------------------------RTTA------------
K7ZLN6_E1B19K-01          ----------------------------------RTTA------------
E1CIR1_E1B19K-01          ----------------------------------RTTA------------
E1AI10_E1B19K-02          GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A384ZUF2_E1B19K-02      GCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
R4HLA0_E1B19K-01          ----------------------------------RTAA------------
Q2KSL3_E1B19K-01          ----------------------------------RTAA------------
A0A5J6CTQ0_E1B19K-01      ----------------------------------RTAA------------
I6LES1_E1B19K-01          ----------------------------------RTAA------------
Q2KSL3_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
I6LEP5_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
I6LES1_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
T1UF50_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
M0QV08_E1B19K-01          ----------------------------------RTTA------------
G9JUV5_E1B19K-01          ----------------------------------RTTA------------
M0QV08_E1B19K-02          GCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UFS4_E1B19K-01          ----------------------------------RTAA------------
T1UFS4_E1B19K-02          GCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRC
X4YVU5_E1B19K-01          ----------------------------------RTTA------------
E1CIJ0_E1B19K-01          ----------------------------------RTTA------------
T1UGU0_E1B19K-01          ----------------------------------RTTA------------
Q2KSM8_E1B19K-02          ----------------------------------RTTA------------
A0A2R3WNP3_E1B19K-01      ----------------------------------RTTA------------
Q2KSG6_E1B19K-01          ----------------------------------RTTA------------
Q5GFC7_E1B19K-01          ----------------------------------RTTA------------
Q5GFC8_E1B19K-01          ----------------------------------RTTA------------
Q6H1D7_E1B19K-01          ----------------------------------RTTA------------
T1UGY3_E1B19K-01          ----------------------------------RTTA------------
A0A7U3S1T6_E1B19K-01      ----------------------------------RTAA------------
J7ID56_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
T1UKP8_E1B19K-01          ----------------------------------RTTA------------
A0A075TSZ1_E1B19K-02      GCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A897JQR0_E1B19K-01      ----------------------------------RTAA------------
I1V161_E1B19K-01          ----------------------------------RTAA------------
A0A5P8KYF0_E1B19K-01      ----------------------------------RTAA------------
J7I6S4_E1B19K-01          ----------------------------------RTAA------------
A0A897JQR0_E1B19K-02      GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
I1V161_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
A0A5P8KYF0_E1B19K-02      GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
J7I6S4_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
T1UEX7_E1B19K-01          ----------------------------------RTVA------------
T1UE63_E1B19K-01          ----------------------------------RTAA------------
Q6RK98_E1B19K-01          ----------------------------------RTAA------------
J7I6Q4_E1B19K-01          ----------------------------------RTAA------------
J7I6Q4_E1B19K-02          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
A0A4P2SGW2_E1B19K-01      ----------------------------------RAAA------------
E1ARN8_E1B19K-01          ----------------------------------RAAA------------
A0A6M5E4Y6_E1B19K-01      ----------------------------------RAAA------------
P03247_E1B19K-01          ----------------------------------RAAA------------
A0A3G8W3H5_E1B19K-01      ----------------------------------RAAA------------
E1U5L6_E1B19K-01          ----------------------------------RAAA------------
A0A516UYI9_E1B19K-01      ----------------------------------RAAA------------
J9Z5H0_E1B19K-01          ----------------------------------RAAA------------
Q6VGV8_E1B19K-01          ----------------------------------RAAA------------
A0A0G2R248_E1B19K-01      ----------------------------------RAAA------------
A0A0G2R248_E1B19K-02      GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
J9Z5H0_E1B19K-02          GVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERC
A0A1P7YXN8_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
A0A1P8C849_E1B19K-02      GCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKC
T1UG22_E1B19K-01          ----------------------------------RTTA------------
A0A2L1F392_E1B19K-01      ----------------------------------RTTA------------
A0A2R3WN16_E1B19K-01      ----------------------------------RTTA------------
A0A2R3WN62_E1B19K-01      ----------------------------------RTTA------------
Q6H1D7_E1B19K-02          GCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERC
A0A6M6AEV2_E1B19K-01      ----------------------------------RTVS------------
A0A6M6AES6_E1B19K-01      ----------------------------------RTVS------------
A0A9X9P8C6_E1B19K-01      ----------------------------------RTVS------------
A0A6B9DS29_E1B19K-01      ----------------------------------RTVS------------
W0S1G8_E1B19K-01          ----------------------------------RTVS------------
J9Z4H6_E1B19K-01          ----------------------------------RAAA------------
I6LES1_E1B19K-03          GCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERC
A0A2H5AI04_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AI72_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIL3_E1B19K-01      ----------------------------------RTVA------------
A0A0M5L3Y4_E1B19K-01      ----------------------------------RTVA------------
Q5C8R2_E1B19K-01          ----------------------------------RTVA------------
A0A2H5AII9_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIN5_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIU0_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIL0_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIS9_E1B19K-01      ----------------------------------RTVA------------
A0A2H5AIT6_E1B19K-01      ----------------------------------RTVA------------
M9YXY5_E1B19K-01          ----------------------------------RTVV------------
H9AAS0_E1B19K-01          ----------------------------------RAVA------------
H9AAV3_E1B19K-01          ----------------------------------RAVA------------
H9AAY5_E1B19K-01          ----------------------------------RAVA------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          VLAILNEGDAHIRHNAASENACFVLLKGMAILKHNMVCGVSD--QTMRRF
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          NLGILNEGEARVSHCASSETGCFILIKGNANVKHNMICGPSD--ERPYQM
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      TLGISSEGFLHAGDNVASDNGCAFLIKGGGRICHNMICGPGDVPPKPYQM
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          VLALIVEGDAHIRHNAASENTCFVLVKGMAVLRHNMVCGVSD--QSARRY
Q2KSM8_E1B19K-03          HLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASD--ERGYQM
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          YLGVSTEGNARVRHCSSIETGCFCLVKGTASLKHNVIKGCTD--ERMYNM
J9Z4H6_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          VLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGVSD--QTMRRF
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      ILAMVVEGQARIRHNAGSENVCFLLLKGTASVKHNMICGTG-----HSQL
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          VIALAVEGYGRIRNNAASENGCFLLLKGTASVKHNMICGSG---LCPSQL
Q32UI6_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          HLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASD--ERGYQM
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          YLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          YLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTD--ERMYNM
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
M0QUN2_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
C4P207_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          YLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTD--ERMYNM
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
M0QVK6_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
M0QVT4_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      YLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTD--ERMYNM
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
G1FC01_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
R4HLA0_E1B19K-02          NLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHSD--ERPYQM
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          YLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      VLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGVSD--QTMRRF
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          NLGILNEGEARVRHCAATETACFILIKGNASVKHNMICGHSD--ERPYQM
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0A1P7YWY2_E1B19K-02      YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          HLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASD--ERGYQM
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      YLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNVVKGCTD--ERMYNM
F8UFP5_E1B19K-02          YLGVSTEGNARVRHCSSMETGCFCLVKGTASIKHNMVKGCTD--ERMYNM
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UGT5_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
T1UGX3_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UHG3_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          YLGVSTEGNARVRHCSSMETGCFCLVKGTASLKHNVVKGCTD--ERMYNM
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1UHZ2_E1B19K-02          YLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UKP8_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UKQ0_E1B19K-02          YLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTD--ERMYNM
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1ULJ8_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          YLGVSTEGNARVRHCSSMETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          YLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSN--ERPYQM
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      YLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTD--ERMYNM
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A384ZUF2_E1B19K-02      YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
I6LEP5_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
I6LES1_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
T1UF50_E1B19K-02          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          YLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          NLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD--ERPYQM
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          NLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHSD--ERPYQM
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      YLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTD--ERMYNM
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
I1V161_E1B19K-02          NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
A0A5P8KYF0_E1B19K-02      NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
J7I6S4_E1B19K-02          NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          NLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
J9Z5H0_E1B19K-02          TLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCE--DRASQM
A0A1P7YXN8_E1B19K-02      YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
A0A1P8C849_E1B19K-02      YLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTD--ERMYNM
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          HLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASD--ERGYQM
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          NLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSD--ERPYQM
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          ------------AAAAASV-----A-ANT---------------------
Q6RK98_E1B19K-03          ------------A-AAATA-----A-ANT---------------------
P04492_E1B19K-02          VTCADGNCHTLKTVHIVSHSRHCWP-VCDHNMFMRCTIHLGLRRGMFRPS
Q2KSM8_E1B19K-01          ------------AVAFFAFVLDKWS-QET---------------------
M9YVF6_E1B19K-01          ------------SVAFICFLLDKWS-SDS---------------------
T2CI10_E1B19K-01          ------------AVAFLTFIFDKWI-PQT---------------------
A0A1W5PVU4_E1B19K-01      ------------ALAFCAFILDKWN-KET---------------------
A0A3Q9HK00_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A9X9PKC1_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A5K6WAR5_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
T2CI10_E1B19K-02          LTCAGGHCNMLATVHIVSHPRKKWP-VLEHNVMTKCTMHVGGRRGMLMPY
A0A2H5AIC5_E1B19K-01      ------------SAAFITYILDQWSNSDS---------------------
A0A0M4N3Z1_E1B19K-01      ------------AVAFASYLLDRWN-TRT---------------------
A0A3S9SPV1_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A9W3HRK4_E1B19K-02      VTCTDGKVRMLKPVHIVGHRRHRWP-EFEHNVMTRCSLYLGGRRGVFMPR
A0A7L4WJT1_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
D3JIR7_E1B19K-02          VTCADGNCHALKTIHVVSHVKHRWP-VCDHNMFMRCSMHLGLRRGMFVPF
Q2KSM8_E1B19K-03          LTCAGGNSHMLATVHVASHPRKPWP-EFEHNVMTRCNMHLGARRGMLMLY
A0A7U3RVU4_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
F2WTM9_E1B19K-01          ------------AIAFAAFILDRWN-SQT---------------------
A0A0M4NHE0_E1B19K-01      ------------AIAFAAFLLDRWN-AQT---------------------
A0A2H4PJ75_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
G0ZAH2_E1B19K-01          ------------GLAFLAYLLDRWD-ENS---------------------
P10406_E1B19K-01          ------------AVAFFAFIFDKWS-QET---------------------
M0QU02_E1B19K-02          LTCDSGVCHILKNIHITSHARKKWP-VFENNMLIKCHVHLGVRRGTFQPY
J9Z4H6_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
P04492_E1B19K-01          ------------SIAFLATILDKWS-EKS---------------------
A0A898KBW7_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A7L4WG90_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3S9SND6_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
J7I6T8_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
A0A5H2QAX5_E1B19K-01      ------------SIAFLATVLDKWS-ERS---------------------
Q6QPB7_E1B19K-01          ------------AVAFFAFILDKWS-QET---------------------
A0A8G1GLF6_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
T1UG63_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
A0A3Q9HJ63_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
T1UEX7_E1B19K-02          VTCADGNCHTLKTVHIVSHARYCWP-VCDHNMFMRCTIHLGLRRGVFRPS
F6KST6_E1B19K-01          ------------ALAFVVHLLDRWN-EQT---------------------
A0A482EVC6_E1B19K-02      LTCADGNCQTLKVIHVVSHQRRPWP-VFEHNMLMRCTMHLGARRGMFSPY
A0A3Q9HK78_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
H9AAA8_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
A0MK43_E1B19K-02          LTCADGNCHTLRTVHIVSHSRRTWP-TFEHNMLMRCAVHLGARRGVFMPY
Q32UI6_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
A0A3S6PYX7_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
Q5GFC7_E1B19K-03          LTCAGGNSHMLAAVHVASHSRKPWP-EFEHNVMTRCNMHLGARRGMFMPY
A0A3Q9HJ54_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A898KBR0_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
J9Z4N4_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
P10544_E1B19K-01          ------------GLAFICFILDQWS-AQT---------------------
F4ZCJ8_E1B19K-01          ------------GLAFICFILDQWS-AQT---------------------
Q8UY91_E1B19K-01          ------------AVAFFAFILDKWS-QET---------------------
A0A9W3I4N3_E1B19K-01      ------------ALAFAVHLLDRWN-EQT---------------------
A0A1L3INW0_E1B19K-01      ------------GLAFVVHLLDRWN-QET---------------------
A0A097IW62_E1B19K-01      ------------ALAFCTYILDRWN-KET---------------------
A0A3G4W995_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A7D0TLU2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
G9G841_E1B19K-01          ------------AVAFFAFLLDKWS-QET---------------------
Q6VGV8_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
P06501_E1B19K-01          ------------AVAFASYLLDRWN-TRT---------------------
Q71BY5_E1B19K-01          -----------------------LT-C-----------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          -----------------------SM-S-----------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          -----------------------VL-T-----------------------
Q5GFC7_E1B19K-04          -----------------------VL-T-----------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ------------AIAFAAFILDRWN-TQT---------------------
W6EIX6_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
W6EIX6_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
Q7T8D8_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
Q7T8D8_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVMTKCTMHAGGRRGMFMPY
Q8B8U7_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
Q32UI6_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
B9A5Q1_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
B9A5T7_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QU76_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QU76_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A0B4SJH1_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A0B4SJH1_E1B19K-02      LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
Q2KS85_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q2KS85_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
C5HDR2_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
C5HDR2_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
D3GBW3_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QUB4_E1B19K-02          LTCDSGVCHILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
W8CZB0_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
W8CZB0_E1B19K-02          LTCDSGVCHILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QUF3_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QUF3_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QUJ3_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QUJ3_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QUN2_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
C4P207_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
R4HLJ6_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
R4HLJ6_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
M0QTS5_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QTS5_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHVHLGARRGTFQPY
M0QUS9_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QUS9_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
Q3ZL02_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
Q3ZL02_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
M0QV47_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
M0QV47_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
M0QV87_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QV87_E1B19K-02          LTCDSGVCHILKNIHVTSHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QVC7_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QVC7_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QVG6_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
M0QVG6_E1B19K-02          LTCDSGVCHILKNIHVTSHARKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QVK6_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
M0QVP5_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
M0QVP5_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
Q4KSL0_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QUW8_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
M0QUW8_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
A0A3G9JTX5_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
A0A3G9K5X3_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
A0A3G9CMQ4_E1B19K-01      ------------AVAFFAFIFDKWS-QET---------------------
Q3ZKW2_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q3ZKW2_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
M0QVT4_E1B19K-02          LTCDSGVCHILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0MK43_E1B19K-01          ------------SAAFITYILDQWSNSDS---------------------
A0A3Q9FFS0_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
A0A3Q9FFS0_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
E5RWD9_E1B19K-01          ------------GVACVVFLVDKWS-QNT---------------------
B9A5L5_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A7G5F9T0_E1B19K-01      ------------AVAFLTFILDKWI-PQT---------------------
A0A7G5FB98_E1B19K-01      ------------AVAFLTFILDKWI-PQT---------------------
A0A7G5FB98_E1B19K-02      LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
C7SRS7_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
A0A1Y1BXT7_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
E9P585_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
E9P585_E1B19K-02          LTCDSGVCYILKNIHVTAHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
G1FC01_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
G1DE13_E1B19K-01          ------------SIAFLVTVLDKWS-ERS---------------------
G1FBW4_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
G1FBW4_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
R4HLA0_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
H5T740_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
K7NG43_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
T1UHL7_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1UHL7_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
R4HMC6_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
R4HMC6_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
W8VNG2_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
A0A3G8WH01_E1B19K-01      ------------SIAFLATILDKWS-EKS---------------------
D3JIR7_E1B19K-01          ------------SIAFLVTVLDKWS-QTS---------------------
A0A5H2QAX5_E1B19K-02      VTCADGNCHTLKTVHIVSHARYCWP-VCDHNMFMRCTIHLGLRRGVFRPS
D0Z5R9_E1B19K-01          ------------SIAFLATVLDKWS-ERS---------------------
Q2KRU2_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
R4HLE1_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
R4HLE1_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
Q7T951_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
A0A8B0L9Y2_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A8B0LBX6_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A8B0LCV0_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A8B0LD36_E1B19K-01      ------------AVAFLIFILDKWI-RQT---------------------
Q2Y0J3_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q2Y0J3_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
A0A220VZ73_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ------------AVAFLTFILDKWI-RQT---------------------
Q5EY83_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q5EY83_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
A0A7D6TSN5_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
Q71BY5_E1B19K-02          -----------------------LT-C-----------------------
Q71BY5_E1B19K-04          ------------AVAFLSFIKDKWS-EET---------------------
A0A1U9ALK7_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A4P2SGW2_E1B19K-02      LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
P03246_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
Q6WQ37_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
E1U5L6_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
E1U5L6_E1B19K-03          -----------------------SM-S-----------------------
F1DT57_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
F1DT57_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNMLIKCHMHLGARRGTFQPY
A0A1P7YWR9_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A1P7YWR9_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A1P7YWY2_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A1P7YWY2_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A1P7YXN8_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A1P7YYY5_E1B19K-02      LTCDSGVCHILKNMHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A1P7YYY5_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A1P8C849_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
B9A5A7_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QU02_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A3G8W6L2_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
Q2KSG6_E1B19K-02          ------------AVAFFAFVLDKWS-QET---------------------
Q2KSG6_E1B19K-04          -----------------------VL-T-----------------------
Q2KSG6_E1B19K-03          LTCAGGNSHMLATVHVASHPRKPWP-EFEHNVMTRCNMHLGARRGMLMLY
Q5GFC7_E1B19K-02          ------------AVAFFAFIFDKWS-QET---------------------
A0A142G3J2_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
P10543_E1B19K-01          ------------GLAFICFILDQWS-AQT---------------------
A0A1S6ELT2_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A3G8W407_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A482EVC6_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A7U3RWV6_E1B19K-01      ------------GVGLIWCVCIQES-AYT---------------------
A0A898KBS1_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A513TZR1_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A516UYM9_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A0K0PX35_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A0K0PX99_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A6M6AA96_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
I6LEP5_E1B19K-03          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
I6LEP5_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
J7ID56_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
T1UE63_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
T1UF50_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
T1UIP3_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
T1UJX4_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
T1UJX4_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
A0A291P1B2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3Q9HJZ5_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3Q9HLF7_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3S9SNH4_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3S9SNY0_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3S9SP19_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A3S9SSS2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A6M4W5T4_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A7D0TN91_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A7L4WGT1_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A7L4WIC2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A7L4WIG2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A7L4WK62_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A8F9W8V2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
E1ARN8_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
J7I6T8_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
J9Z4N4_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
T1UG63_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
A0A075TSZ1_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A097I4T0_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
A0A097I4T0_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A0G2UY10_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
A0A0G2UY10_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A1J0MS84_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
A0A291B0H2_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A384ZUF2_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A384ZUM9_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
A0A384ZUM9_E1B19K-02      LTCDSGVCHILKNIHVTSHARKKWP-VFENNLLIKCHMHLGARRGTFQPY
F8UFP5_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGVRRGTFQPY
F8UFP5_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
G3CK71_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
G3CK71_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
T1UG22_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UGT5_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-LFENNLLIKCHVHLGARRGTFQPY
T1UGT5_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
T1UGU0_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
T1UGX3_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHVHLGARRGTFQPY
T1UGX3_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
T1UGY3_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UHG3_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UHG3_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1UHH6_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UHH6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1UHQ8_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1UHQ8_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNMLIKCHMHLGARRGTFQPY
T1UHZ2_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UK99_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
T1UK99_E1B19K-02          LTCDSGVCHILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UKP8_E1B19K-02          LTCDSGVCHILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UKQ0_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKRWP-SFENNVLIKCHVHLGARRGTFQPY
T1UKQ0_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
T1UKV6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1UKV6_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1ULJ8_E1B19K-02          LTCDSGVCYILKNIHVTAHSRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1ULJ8_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
T1ULP4_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
X4Y9D2_E1B19K-01          ------------GVAFVVFLVDKWR-QDT---------------------
A0A0A1EUB2_E1B19K-01      ------------SAAFITYILDQWSNSGS---------------------
A0A0A1EUC8_E1B19K-01      ------------SAAFITYILDQWSNSGS---------------------
A0A0A1EUE4_E1B19K-01      ------------SAAFITYILDQWSSSGS---------------------
A0A2H5AI21_E1B19K-01      ------------SAAFITYILDQWSNSDS---------------------
A0A2H5AI40_E1B19K-01      ------------SAAFVAYILDQWSNSNS---------------------
A0A2H5AI99_E1B19K-01      ------------SLAFICHLLDKWS-SDS---------------------
A0A2H5AID8_E1B19K-01      ------------SAAFVAYILDQWSNSDS---------------------
A0A0M3TH18_E1B19K-01      ------------ALAFCAFILDKWN-KET---------------------
A0A2H4CJZ0_E1B19K-01      ------------ALAFICFVLDRWS-AQT---------------------
H8PFZ1_E1B19K-01          ------------AIAFICFVLDRWS-AQT---------------------
A0A0M3TH31_E1B19K-01      ------------SVAFICFLLDKWS-SDS---------------------
Q6QPF3_E1B19K-01          ------------AVAFFAFILDKWS-QET---------------------
A0A9W3HRK4_E1B19K-01      ------------ALAFAVHLLDRWN-EQT---------------------
F2WTJ7_E1B19K-01          ------------AIAFAAFILDRWN-SQT---------------------
A0A9W3INM3_E1B19K-01      ------------ALAFAVHLLDRWN-EQT---------------------
H9AA76_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
H9AAD9_E1B19K-01          ------------AIAFAAFLLDRWN-AQT---------------------
H9AAH3_E1B19K-01          ------------AIAFAAFLLDRWN-AQT---------------------
H9AAK5_E1B19K-01          ------------AIAFAAFLLDRWN-AQT---------------------
H9AAN8_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
M9YVA3_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
Q6QPI9_E1B19K-01          ------------AVAFFAFILDKWS-QET---------------------
Q8B6X5_E1B19K-01          ------------AVAFASYLLDRWN-TRT---------------------
B5SNR1_E1B19K-01          ------------GLAFICFILDQWS-AQT---------------------
A0A1L7NRH1_E1B19K-01      ------------AVAFLTFILDKWI-PQT---------------------
Q5UW22_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
J7H4R9_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
D2DM83_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
A0A7U3S224_E1B19K-01      ------------AVAFLTFILDKWI-PQT---------------------
J7I6W7_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
J7I6W7_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
M0QUB4_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
C4P207_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
D4N3H6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QVK6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
M0QVT4_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A3G8WIY5_E1B19K-01      ------------GVAFVVFLVDKWS-QDT---------------------
T1ULP4_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A7R6T9I9_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
B6C6W8_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
B9A681_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
A0A1Y1BYF1_E1B19K-01      ------------GVAFVVFLVDKWS-QNT---------------------
T1UHZ2_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QU41_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A075IQ70_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
A0A075IQ70_E1B19K-02      LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
K7NG43_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q2KRU2_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
T1UIP3_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
A0A3S6PYX7_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
G1FC01_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
E5RWL1_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QU41_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
B2VQE3_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
B6DU90_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QUN2_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
E1CIM6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
E1AI10_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
H0PPE7_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
Q9YL99_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
K7ZLN6_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
E1CIR1_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
E1AI10_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A384ZUF2_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
R4HLA0_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q2KSL3_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
A0A5J6CTQ0_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
I6LES1_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
Q2KSL3_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
I6LEP5_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
I6LES1_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
T1UF50_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
M0QV08_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
G9JUV5_E1B19K-01          ------------GVAFVVFLVDKWS-QNT---------------------
M0QV08_E1B19K-02          LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHVHLGARRGTFQPY
T1UFS4_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
T1UFS4_E1B19K-02          LTCAGGHCNMLATVHIVSHQRKKWP-VFDHNVLTKCTMHAGGRRGMFMPY
X4YVU5_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
E1CIJ0_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
T1UGU0_E1B19K-01          ------------GVAFVVFLVDKWS-QQT---------------------
Q2KSM8_E1B19K-02          ------------AVAFFAFVLDKWS-QET---------------------
A0A2R3WNP3_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
Q2KSG6_E1B19K-01          ------------AVAFFAFVLDKWS-QET---------------------
Q5GFC7_E1B19K-01          ------------AVAFFAFIFDKWS-QET---------------------
Q5GFC8_E1B19K-01          ------------AVAFFAFIFDKWS-QET---------------------
Q6H1D7_E1B19K-01          ------------AVAFFAFIFDKWS-QET---------------------
T1UGY3_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A7U3S1T6_E1B19K-01      ------------AVAFLTFILDKWI-PQT---------------------
J7ID56_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
T1UKP8_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A075TSZ1_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A897JQR0_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
I1V161_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
A0A5P8KYF0_E1B19K-01      ------------AVAFLTFILDKWI-RQT---------------------
J7I6S4_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
A0A897JQR0_E1B19K-02      LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
I1V161_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
A0A5P8KYF0_E1B19K-02      LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
J7I6S4_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
T1UEX7_E1B19K-01          ------------SIAFLATVLDKWS-ERS---------------------
T1UE63_E1B19K-01          ------------AVAFLTFILDKWI-PQT---------------------
Q6RK98_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
J7I6Q4_E1B19K-01          ------------AVAFLTFILDKWI-RQT---------------------
J7I6Q4_E1B19K-02          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
A0A4P2SGW2_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
E1ARN8_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
A0A6M5E4Y6_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
P03247_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
A0A3G8W3H5_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
E1U5L6_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
A0A516UYI9_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
J9Z5H0_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
Q6VGV8_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
A0A0G2R248_E1B19K-01      ------------AVAFLSFIKDKWS-EET---------------------
A0A0G2R248_E1B19K-02      LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
J9Z5H0_E1B19K-02          LTCSDGNCHLLKTIHVASHSRKAWP-VFEHNILTRCSLHLGNRRGVFLPY
A0A1P7YXN8_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
A0A1P8C849_E1B19K-02      LTCDSGVCHILKNIHVTSHPRKKWP-VFENNLLIKCHMHLGARRGTFQPY
T1UG22_E1B19K-01          ------------GVAFVVFLVDKWS-QDT---------------------
A0A2L1F392_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
A0A2R3WN16_E1B19K-01      ------------AVAFFAFVLDKWS-QET---------------------
A0A2R3WN62_E1B19K-01      ------------AVAFFAFIFDKWS-QET---------------------
Q6H1D7_E1B19K-02          LTCAGGNSHMLAAVHVASHSRKPWP-EFEHNVMTRCNMHLGARRGMFMPY
A0A6M6AEV2_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A6M6AES6_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A9X9P8C6_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
A0A6B9DS29_E1B19K-01      ------------GLAFICFILDQWS-AQT---------------------
W0S1G8_E1B19K-01          ------------GLAFICFILDQWS-AQT---------------------
J9Z4H6_E1B19K-01          ------------AVAFLSFIKDKWS-EET---------------------
I6LES1_E1B19K-03          LTCAGGHCNILATVHIVSHARKKWP-VFEHNVITKCTMHIGGRRGMFMPY
A0A2H5AI04_E1B19K-01      ------------SAAFITYILDQWSNSGS---------------------
A0A2H5AI72_E1B19K-01      ------------SAAFITYILDQWSNSGS---------------------
A0A2H5AIL3_E1B19K-01      ------------SAAFITYILDQWSNSGS---------------------
A0A0M5L3Y4_E1B19K-01      ------------SAAFITYILDQWSNSDS---------------------
Q5C8R2_E1B19K-01          ------------SAAFITYILDQWSNSDS---------------------
A0A2H5AII9_E1B19K-01      ------------SAAFVAYILDQWSNSNS---------------------
A0A2H5AIN5_E1B19K-01      ------------SAAFVAYILDQWSNSNS---------------------
A0A2H5AIU0_E1B19K-01      ------------SAAFVAYILDQWSNSNS---------------------
A0A2H5AIL0_E1B19K-01      ------------SAAFVAYILDQWSNSDS---------------------
A0A2H5AIS9_E1B19K-01      ------------SAAFVAYILDQWSNSDS---------------------
A0A2H5AIT6_E1B19K-01      ------------SAAFVAYILDQWSNSDS---------------------
M9YXY5_E1B19K-01          ------------SVAFICFLLDKWS-SDS---------------------
H9AAS0_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
H9AAV3_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
H9AAY5_E1B19K-01          ------------AIAFAAFILDRWN-TQT---------------------
                                                                            

Q7T8D8_E1B19K-03          -----------------V-LGMGYYGSIMANST-SSNNPSTL-TQD---K
Q6RK98_E1B19K-03          -----------------I-LGMGYYGSIVANSS-SSNNPSTL-AED---K
P04492_E1B19K-02          QCNFSHSNIMLEPEVFSR-VCLNGVFD-LSVEL-CK--VIRYNDDT-RHR
Q2KSM8_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
M9YVF6_E1B19K-01          -----------------H-LSWDYMLDYMTMAL-WR--ALLR-RR----R
T2CI10_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A1W5PVU4_E1B19K-01      -----------------H-LSRGYTLDYISLQL-WK--AYMR-KG----K
A0A3Q9HK00_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A9X9PKC1_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A5K6WAR5_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
T2CI10_E1B19K-02          QCNMNNVKVMLEPDAFSR-MSLTGIFD-MNLQI-WK--ILRY-DDT-KSR
A0A2H5AIC5_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A0M4N3Z1_E1B19K-01      -----------------H-LSPGYQMDYISLNL-WK--FWLR-RR-----
A0A3S9SPV1_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A9W3HRK4_E1B19K-02      QCNLAHCNVIMEQSAATQ-VCFGGIFD-ISMVV-YK--ILRY-DDC-RAR
A0A7L4WJT1_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
D3JIR7_E1B19K-02          QCNLSHTNVLLEPEVFSR-ISLNGVFD-LSVEL-YK--VIRY-DDT-RHR
Q2KSM8_E1B19K-03          QCNLNYVKVLLEPDAMSR-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
A0A7U3RVU4_E1B19K-01      -----------------H-LSQGYTLDYMAMAL-WR--TLLR-RK----R
F2WTM9_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
A0A0M4NHE0_E1B19K-01      -----------------Q-LSPGYTLDYISLQL-WR--FWLR-R-----R
A0A2H4PJ75_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
G0ZAH2_E1B19K-01          -----------------V-LSPGYRLDCLALAI-WK--HTLR-EG----I
P10406_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
M0QU02_E1B19K-02          QCNFSQTKLLLESDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
J9Z4H6_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
P04492_E1B19K-01          -----------------H-LSWDYMLDYMSMQL-WR--AWLK-RR-----
A0A898KBW7_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A7L4WG90_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3S9SND6_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
J7I6T8_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
A0A5H2QAX5_E1B19K-01      -----------------H-LSWDYMLDYMTMHL-WR--AWLK-RR-----
Q6QPB7_E1B19K-01          -----------------H-FSRDYRLDCLAVAL-WR--TWRC-QRL-N-A
A0A8G1GLF6_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
T1UG63_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
A0A3Q9HJ63_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
T1UEX7_E1B19K-02          QCNFSHSNVMLEPEAFSR-VSLNGVFD-LSVEL-CK--IIRYDDAA-RHR
F6KST6_E1B19K-01          -----------------Q-LSPGYTLDFLTLCL-WK--FGIR-KGR---K
A0A482EVC6_E1B19K-02      QSNFCHTKVLMETDAFSR-VWWSGVFD-LTIEL-YK--VVRY-DEL-KAR
A0A3Q9HK78_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
H9AAA8_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
A0MK43_E1B19K-02          QCNFSHTKILLETDSFPR-VCFNGVFD-MSMEL-FK--VIRY-DET-KSR
Q32UI6_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGMFD-MNMQI-WK--ILRY-DDT-RSR
A0A3S6PYX7_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
Q5GFC7_E1B19K-03          QCNLNYVKVLLEPDVMSR-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
A0A3Q9HJ54_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A898KBR0_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
J9Z4N4_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
P10544_E1B19K-01          -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
F4ZCJ8_E1B19K-01          -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
Q8UY91_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
A0A9W3I4N3_E1B19K-01      -----------------Q-LSPGYTLDFLTLCL-WK--FGIR-RGR---K
A0A1L3INW0_E1B19K-01      -----------------Y-LSPGYTLDFLTLSL-WK--TGLK-RGR---K
A0A097IW62_E1B19K-01      -----------------H-LSAGYTLDYITLQL-WK--AYMR-KG----K
A0A3G4W995_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A7D0TLU2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
G9G841_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKS-QRL-N-A
Q6VGV8_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
P06501_E1B19K-01          -----------------H-LSPGYQMDYISLNL-WK--FWLR-RR-----
Q71BY5_E1B19K-01          -----------------HEAGFPPSDD-EDEEGEEF--VLDY-VEQPGHG
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------V-W---------------
E1ARN8_E1B19K-03          -----------------K-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------V-W---------------
Q2KSM8_E1B19K-04          -----------------R-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
Q5GFC7_E1B19K-04          -----------------R-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
E1ARN8_E1B19K-04          --------------------------------Q-F---------------
E1U5L6_E1B19K-04          --------------------------------Q-F---------------
A0A1C8EG46_E1B19K-01      -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
W6EIX6_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
W6EIX6_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNMQI-WK--ILRY-DDT-RSR
Q7T8D8_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
Q7T8D8_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNMQI-WK--ILRY-DDT-RSR
Q8B8U7_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
Q32UI6_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
B9A5Q1_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
B9A5T7_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QU76_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QU76_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
A0A0B4SJH1_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A0B4SJH1_E1B19K-02      QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
Q2KS85_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2KS85_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
C5HDR2_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
C5HDR2_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
D3GBW3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QUB4_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
W8CZB0_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
W8CZB0_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
M0QUF3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QUF3_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QUJ3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
M0QUJ3_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QUN2_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
C4P207_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
R4HLJ6_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
R4HLJ6_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
M0QTS5_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QTS5_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QUS9_E1B19K-01          -----------------Q-LSRGYILDFTAMHL-WR--AWVR-QRG-Q-R
M0QUS9_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
Q3ZL02_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
Q3ZL02_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNMQI-WK--ILRY-DDT-RSR
M0QV47_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
M0QV47_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
M0QV87_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
M0QV87_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QVC7_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QVC7_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QVG6_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
M0QVG6_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
M0QVK6_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
M0QVP5_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
M0QVP5_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
Q4KSL0_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
M0QUW8_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
M0QUW8_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
A0A3G9JTX5_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
A0A3G9K5X3_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
A0A3G9CMQ4_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
Q3ZKW2_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RSM-R-T
Q3ZKW2_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
M0QVT4_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
A0MK43_E1B19K-01          -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A3Q9FFS0_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
A0A3Q9FFS0_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
E5RWD9_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
B9A5L5_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A7G5F9T0_E1B19K-01      -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
A0A7G5FB98_E1B19K-01      -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
A0A7G5FB98_E1B19K-02      QCNMNHVKVLLEPDAFSR-MSLTGMFD-MNMQI-WK--ILRY-DDT-RSR
C7SRS7_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
A0A1Y1BXT7_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-K
E9P585_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
E9P585_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
G1FC01_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
G1DE13_E1B19K-01          -----------------H-LSWDYMLDYMAMHL-WR--AWLK-RR-----
G1FBW4_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
G1FBW4_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
R4HLA0_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
H5T740_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
K7NG43_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
T1UHL7_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
T1UHL7_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
R4HMC6_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
R4HMC6_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
W8VNG2_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A3G8WH01_E1B19K-01      -----------------H-LSWDYMLDYMSMQL-WR--AWLK-RR-----
D3JIR7_E1B19K-01          -----------------Q-LSWDYMLDYMAMQL-WR--AWLT-RR-----
A0A5H2QAX5_E1B19K-02      QCNFSHSNVLLEPEAFSR-VSLNGVFD-LSVEL-CK--IIRYDDAA-RHR
D0Z5R9_E1B19K-01          -----------------H-LSWDYMLDYMAMHL-WR--AWLK-RR-----
Q2KRU2_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
R4HLE1_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
R4HLE1_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KSR
Q7T951_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
A0A8B0L9Y2_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A8B0LBX6_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A8B0LCV0_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A8B0LD36_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2Y0J3_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2Y0J3_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
A0A220VZ73_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q5EY83_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q5EY83_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSVTGIFD-MNIQL-WK--ILRY-DDT-KPR
Q5EY83_E1B19K-03          ---------MLEPDAFSR-VSVTGIFD-MNIQL-WK--ILRY-DDT-KPR
Q6RK98_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
A0A7D6TSN5_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
Q71BY5_E1B19K-02          -----------------HEAGFPPSDD-EDEEG-----------------
Q71BY5_E1B19K-04          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A1U9ALK7_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A4P2SGW2_E1B19K-02      QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
P03246_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
Q6WQ37_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
E1U5L6_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
E1U5L6_E1B19K-03          -----------------K-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
F1DT57_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
F1DT57_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1P7YWR9_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A1P7YWR9_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1P7YWY2_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1P7YWY2_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A1P7YXN8_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A1P7YYY5_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1P7YYY5_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A1P8C849_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
B9A5A7_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
M0QU02_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A3G8W6L2_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
Q2KSG6_E1B19K-02          -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
Q2KSG6_E1B19K-04          -----------------R-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
Q2KSG6_E1B19K-03          QCNLNYVKVLLEPDAMSR-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
Q5GFC7_E1B19K-02          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
A0A142G3J2_E1B19K-01      -----------------H-LSQGYTLDYMAMAL-WR--TLLR-RK----R
P10543_E1B19K-01          -----------------H-LSQGYTLDYMAMAL-WR--TLLR-RK----R
A0A1S6ELT2_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A3G8W407_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A482EVC6_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A7U3RWV6_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A898KBS1_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A513TZR1_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A516UYM9_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A0K0PX35_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A0K0PX99_E1B19K-01      -----------------H-FSRGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A6M6AA96_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
I6LEP5_E1B19K-03          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
I6LEP5_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
J7ID56_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
T1UE63_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNTQI-WK--ILRY-DDT-RSR
T1UF50_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
T1UIP3_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
T1UJX4_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
T1UJX4_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNTQI-WK--ILRY-DDT-RSR
A0A291P1B2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3Q9HJZ5_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---G
A0A3Q9HLF7_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3S9SNH4_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3S9SNY0_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3S9SP19_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3S9SSS2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A6M4W5T4_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A7D0TN91_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A7L4WGT1_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A7L4WIC2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A7L4WIG2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A7L4WK62_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A8F9W8V2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
E1ARN8_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
J7I6T8_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
J9Z4N4_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
T1UG63_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A075TSZ1_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
A0A097I4T0_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
A0A097I4T0_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A0G2UY10_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
A0A0G2UY10_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1J0MS84_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--SWVR-QRG-Q-R
A0A291B0H2_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A384ZUF2_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A384ZUM9_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A384ZUM9_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
F8UFP5_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
F8UFP5_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
G3CK71_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
G3CK71_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
T1UG22_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UGT5_E1B19K-02          QCNLSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UGT5_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
T1UGU0_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
T1UGX3_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UGX3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
T1UGY3_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UHG3_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UHG3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
T1UHH6_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UHH6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
T1UHQ8_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
T1UHQ8_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UHZ2_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UK99_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
T1UK99_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
T1UKP8_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
T1UKQ0_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
T1UKQ0_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
T1UKV6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
T1UKV6_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1ULJ8_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
T1ULJ8_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
T1ULP4_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
X4Y9D2_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
A0A0A1EUB2_E1B19K-01      -----------------H-LSWEYMLDYMSMAL-WR--AMLR-RR-----
A0A0A1EUC8_E1B19K-01      -----------------H-LSWEYMLDYMSMAL-WR--AMLR-RR-----
A0A0A1EUE4_E1B19K-01      -----------------H-LSWDYMLDYLAMAL-WR--AMLR-RR-----
A0A2H5AI21_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AI40_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AI99_E1B19K-01      -----------------H-LSWNYMLDYLSMAV-WR--AMLR-KR-----
A0A2H5AID8_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A0M3TH18_E1B19K-01      -----------------H-LSKGYTLDYISLQL-WK--AYMR-KG----K
A0A2H4CJZ0_E1B19K-01      -----------------R-LSPGYTLDYLTMSL-WR--AMLR-KR----R
H8PFZ1_E1B19K-01          -----------------R-LSPGYTLDYLTMSL-WR--AMLR-KR----R
A0A0M3TH31_E1B19K-01      -----------------H-LSWDYMLDYMTMAL-WR--ALLR-RR----R
Q6QPF3_E1B19K-01          -----------------H-FSRDYRLDCLAVAL-WR--TWRC-QRL-N-A
A0A9W3HRK4_E1B19K-01      -----------------Q-LSPGYTLDFLTLCL-WK--FGIR-RGR---K
F2WTJ7_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
A0A9W3INM3_E1B19K-01      -----------------Q-LSPGYTLDFLTLCL-WK--FGIR-RGR---K
H9AA76_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
H9AAD9_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-R-----R
H9AAH3_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-R-----R
H9AAK5_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-R-----R
H9AAN8_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
M9YVA3_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
Q6QPI9_E1B19K-01          -----------------H-FSRDYRLDCLAVAL-WR--TWRC-QRL-N-A
Q8B6X5_E1B19K-01          -----------------H-LSPGYQMDYIRLNL-WK--FWLR-RR-----
B5SNR1_E1B19K-01          -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A1L7NRH1_E1B19K-01      -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
Q5UW22_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
J7H4R9_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
D2DM83_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
A0A7U3S224_E1B19K-01      -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
J7I6W7_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
J7I6W7_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGMFD-MNMQI-WK--ILRY-DDT-RSR
M0QUB4_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
C4P207_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
D4N3H6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
M0QVK6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
M0QVT4_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A3G8WIY5_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
T1ULP4_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
A0A7R6T9I9_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
B6C6W8_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
B9A681_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
A0A1Y1BYF1_E1B19K-01      -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
T1UHZ2_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QU41_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-RSR
A0A075IQ70_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A075IQ70_E1B19K-02      QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
K7NG43_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2KRU2_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
T1UIP3_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A3S6PYX7_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
G1FC01_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
E5RWL1_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QU41_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
B2VQE3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
B6DU90_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QUN2_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
E1CIM6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
E1AI10_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
H0PPE7_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
Q9YL99_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
K7ZLN6_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
E1CIR1_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWIR-QRG-Q-R
E1AI10_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A384ZUF2_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
R4HLA0_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2KSL3_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A5J6CTQ0_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
I6LES1_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
Q2KSL3_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
I6LEP5_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
I6LES1_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
T1UF50_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
M0QV08_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
G9JUV5_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWVR-QRG-Q-R
M0QV08_E1B19K-02          QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UFS4_E1B19K-01          -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
T1UFS4_E1B19K-02          QCNMNHVKVLLEPDAFSR-MSLTGIFD-MNMQI-WK--ILRY-DDT-RSR
X4YVU5_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
E1CIJ0_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
T1UGU0_E1B19K-01          -----------------H-LTRDYILDFTAMHL-WK--AWVR-QRG-Q-R
Q2KSM8_E1B19K-02          -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
A0A2R3WNP3_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
Q2KSG6_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
Q5GFC7_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
Q5GFC8_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
Q6H1D7_E1B19K-01          -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
T1UGY3_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A7U3S1T6_E1B19K-01      -----------------H-FSRGYVLDFVATAL-WR--TWKV-RKM-R-T
J7ID56_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
T1UKP8_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--SWIR-QRG-Q-R
A0A075TSZ1_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A897JQR0_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
I1V161_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A5P8KYF0_E1B19K-01      -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
J7I6S4_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
A0A897JQR0_E1B19K-02      QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
I1V161_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
A0A5P8KYF0_E1B19K-02      QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
J7I6S4_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
T1UEX7_E1B19K-01          -----------------H-LSWDYMLDYMAMHL-WR--AWLK-RR-----
T1UE63_E1B19K-01          -----------------H-FSRGYVLDFIATAL-WR--TWKV-RKM-R-T
Q6RK98_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
J7I6Q4_E1B19K-01          -----------------H-FSKGYVLDFIAAAL-WR--TWKA-RRM-R-T
J7I6Q4_E1B19K-02          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
A0A4P2SGW2_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
E1ARN8_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A6M5E4Y6_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
P03247_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A3G8W3H5_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
E1U5L6_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A516UYI9_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
J9Z5H0_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
Q6VGV8_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A0G2R248_E1B19K-01      -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
A0A0G2R248_E1B19K-02      QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
J9Z5H0_E1B19K-02          QCNLSHTKILLEPESMSK-VNLNGVFD-MTMKI-WK--VLRY-DET-RTR
A0A1P7YXN8_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
A0A1P8C849_E1B19K-02      QCNFSQTKLLLENDAFSR-VNLNGIFD-MDVSV-YK--ILRY-DET-KSR
T1UG22_E1B19K-01          -----------------Q-LSRGYILDFAAMHL-WR--AWMR-QRG-Q-R
A0A2L1F392_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
A0A2R3WN16_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--AWKC-QRL-N-A
A0A2R3WN62_E1B19K-01      -----------------H-FSRDYQLDFLAVAL-WR--TWKC-QRL-N-A
Q6H1D7_E1B19K-02          QCNLNYVKVLLEPDVMSR-VSLTGVFD-MNVEV-WK--ILRY-DEY-KTR
A0A6M6AEV2_E1B19K-01      -----------------H-LSQGYTLDYMAMAL-WR--TLLR-RK----R
A0A6M6AES6_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A9X9P8C6_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
A0A6B9DS29_E1B19K-01      -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
W0S1G8_E1B19K-01          -----------------H-LSEGYTLDYMTMAL-WR--TLLR-RK----R
J9Z4H6_E1B19K-01          -----------------H-LSGGYLLDFLAMHL-WR--AVVR-HKN---R
I6LES1_E1B19K-03          QCNMNHVKVMLEPDAFSR-VSLTGIFD-MNIQL-WK--ILRY-DDT-KPR
A0A2H5AI04_E1B19K-01      -----------------H-LSWEYMLDYMSMAL-WR--AMLR-RR-----
A0A2H5AI72_E1B19K-01      -----------------H-LSWEYMLDYMSMAL-WR--AMLR-RR-----
A0A2H5AIL3_E1B19K-01      -----------------H-LSWEYMLDYMSMAL-WR--AMLR-RR-----
A0A0M5L3Y4_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
Q5C8R2_E1B19K-01          -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AII9_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AIN5_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AIU0_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AIL0_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AIS9_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
A0A2H5AIT6_E1B19K-01      -----------------H-LSWEYMLDYMAMAL-WR--AMLR-RR-----
M9YXY5_E1B19K-01          -----------------H-LSWDYMLDYMTMAL-WR--ALLR-RR----R
H9AAS0_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
H9AAV3_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
H9AAY5_E1B19K-01          -----------------Q-LSPGYTLDYISLQL-WR--FWLR-RR-----
                                                                            

Q7T8D8_E1B19K-03          LLVLLA-QLEA--L------------TQR-L-------------------
Q6RK98_E1B19K-03          LLVLLA-QLEA--L------------TQR-L-------------------
P04492_E1B19K-02          CRQCEC-GSSHLEL------------RPI-V-------------------
Q2KSM8_E1B19K-01          ISGYLP-VQPLDTL------------RIL-S-------------------
M9YVF6_E1B19K-01          ACIYLP-VQPQQGL------------ERV-E-------------------
T2CI10_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
A0A1W5PVU4_E1B19K-01      IYTFSQ--GPR--S------------LPQ-R-------------------
A0A3Q9HK00_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A9X9PKC1_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A5K6WAR5_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
T2CI10_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A2H5AIC5_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A0M4N3Z1_E1B19K-01      VYNYSR-GLPQLGP------------VAP-L-------------------
A0A3S9SPV1_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A9W3HRK4_E1B19K-02      TRTCDC-GASHLCN------------LTV-M-------------------
A0A7L4WJT1_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
D3JIR7_E1B19K-02          CRQCEC-GSSHLEL------------RPV-L-------------------
Q2KSM8_E1B19K-03          CRACEC-GGKHARF------------QPV-C-------------------
A0A7U3RVU4_E1B19K-01      VLGCLP-AQRPHGL------------DPV-Q-------------------
F2WTM9_E1B19K-01          VYNYSR-GLPPLGR------------ASL-P-------------------
A0A0M4NHE0_E1B19K-01      VYNYSR-GLPPLGL------------ASV-A-------------------
A0A2H4PJ75_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
G0ZAH2_E1B19K-01          LRGVMQ--GPRARVNREIRREVEERLTQV-Q-------------------
P10406_E1B19K-01          I-------------------------------------------------
M0QU02_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
J9Z4H6_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
P04492_E1B19K-01          VCIYSL-ARPL--T------------MPPLP-------------------
A0A898KBW7_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A7L4WG90_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A3S9SND6_E1B19K-01      MLLLSS-VRPA--I------------IPT-E-------------------
J7I6T8_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
A0A5H2QAX5_E1B19K-01      VCIYSL-ARPL--T------------MPPLQ-------------------
Q6QPB7_E1B19K-01          ISGYLP-VQPVDTL------------RIL-S-------------------
A0A8G1GLF6_E1B19K-01      VLGCSP-AQPPHGL------------DPV-X-------------------
T1UG63_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
A0A3Q9HJ63_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
T1UEX7_E1B19K-02          CRQCEC-GSSHLEL------------RPV-M-------------------
F6KST6_E1B19K-01          LYRRLVERHPS--L------------RQH-R-------------------
A0A482EVC6_E1B19K-02      CRPCEC-GANHIRL------------YPA-T-------------------
A0A3Q9HK78_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
H9AAA8_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
A0MK43_E1B19K-02          CRSCEC-GANHLRL------------YPV-T-------------------
Q32UI6_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A3S6PYX7_E1B19K-01      ILNYWL-IQPAAP-------------GLL-R-------------------
Q5GFC7_E1B19K-03          CRACEC-GGKHARF------------QPV-C-------------------
A0A3Q9HJ54_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A898KBR0_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
J9Z4N4_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
P10544_E1B19K-01          VLGCSP-AQPPHGL------------DPV-R-------------------
F4ZCJ8_E1B19K-01          VLGCSP-AQPPHGL------------DPV-R-------------------
Q8UY91_E1B19K-01          ISGYLP-VQPLDTL------------RIL-N-------------------
A0A9W3I4N3_E1B19K-01      LYGRLVERHPS--L------------RQQ-R-------------------
A0A1L3INW0_E1B19K-01      LYGRMLERHPS--L------------IQK-T-------------------
A0A097IW62_E1B19K-01      IYTFSR--EPR--S------------LQR-L-------------------
A0A3G4W995_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A7D0TLU2_E1B19K-01      LLLLSA-VHLA--I------------IPT-L-------------------
G9G841_E1B19K-01          ISGYLP-VQPLDTL------------KIL-N-------------------
Q6VGV8_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
P06501_E1B19K-01          VYNYSR-GLPQLGP------------AAP-L-------------------
Q71BY5_E1B19K-01          CRSCHY-HRRNTGD------------PDI-MCSLCYMRTCGMFVYSPVSE
Q71BY5_E1B19K-03          --------NRNLQD------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          CRPCEC-GGKHIRN------------QPV-M-------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          CRACEC-GGKHARF------------QPV-C-------------------
Q5GFC7_E1B19K-04          CRACEC-GGKHARF------------QPV-C-------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      VYNYSR-GLPPLGR------------ASS-P-------------------
W6EIX6_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
W6EIX6_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
Q7T8D8_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
Q7T8D8_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
Q8B8U7_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
Q32UI6_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
B9A5Q1_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
B9A5T7_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QU76_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QU76_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0A0B4SJH1_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A0B4SJH1_E1B19K-02      VRACEC-GGKHARF------------QPV-C-------------------
Q2KS85_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q2KS85_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
C5HDR2_E1B19K-01          ILNYWL-IQPAVP-------------GLL-R-------------------
C5HDR2_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
D3GBW3_E1B19K-01          ILNYWL-IQPAVP-------------GLL-R-------------------
M0QUB4_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
W8CZB0_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
W8CZB0_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QUF3_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QUF3_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QUJ3_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QUJ3_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QUN2_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
C4P207_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
R4HLJ6_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
R4HLJ6_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
M0QTS5_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QTS5_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QUS9_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QUS9_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
Q3ZL02_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
Q3ZL02_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
M0QV47_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QV47_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QV87_E1B19K-01          ILNYWL-LQPAVP-------------GLL-R-------------------
M0QV87_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QVC7_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QVC7_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QVG6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QVG6_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QVK6_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
M0QVP5_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QVP5_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
Q4KSL0_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QUW8_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QUW8_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0A3G9JTX5_E1B19K-01      I-------------------------------------------------
A0A3G9K5X3_E1B19K-01      ISGYLP-VQPLDTL------------RIL-S-------------------
A0A3G9CMQ4_E1B19K-01      ISGYLP-VQPLDTL------------RIL-S-------------------
Q3ZKW2_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q3ZKW2_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
M0QVT4_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0MK43_E1B19K-01          VCIYLR-AQPP--R------------LDRVV-------------------
A0A3Q9FFS0_E1B19K-01      ILNYWL-IQPAAP-------------GLL-R-------------------
A0A3Q9FFS0_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
E5RWD9_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
B9A5L5_E1B19K-01          ILNYWL-LQPAAS-------------GLL-H-------------------
A0A7G5F9T0_E1B19K-01      ILGYWP-VQPLGVA------------GIL---------------------
A0A7G5FB98_E1B19K-01      ILGYWP-VQPLGVA------------GIL---------------------
A0A7G5FB98_E1B19K-02      VRACEC-GGKHARF------------QPV-C-------------------
C7SRS7_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
A0A1Y1BXT7_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
E9P585_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E9P585_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
G1FC01_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
G1DE13_E1B19K-01          VCIYSL-ARPL--T------------MPPLQ-------------------
G1FBW4_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
G1FBW4_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
R4HLA0_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
H5T740_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
K7NG43_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UHL7_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UHL7_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
R4HMC6_E1B19K-01          ILNYWP-VQPLGVA------------GIL---------------------
R4HMC6_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
W8VNG2_E1B19K-01          ILNYWL-LQPAAP-------------GLL-H-------------------
A0A3G8WH01_E1B19K-01      VCIYSL-ARPL--T------------MPPLP-------------------
D3JIR7_E1B19K-01          VCIYSL-ARPL--T------------MPRLP-------------------
A0A5H2QAX5_E1B19K-02      CRQCEC-GSSHLEL------------RPV-M-------------------
D0Z5R9_E1B19K-01          VCIYSL-ARPL--T------------MPPLQ-------------------
Q2KRU2_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
R4HLE1_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
R4HLE1_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
Q7T951_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
A0A8B0L9Y2_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A8B0LBX6_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A8B0LCV0_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A8B0LD36_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
Q2Y0J3_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q2Y0J3_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A220VZ73_E1B19K-01      ILNYWP-VQPLGVA------------GIL---------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ILDYWP-VQPLGVA------------GIL---------------------
Q5EY83_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q5EY83_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
Q5EY83_E1B19K-03          VRACEC-GGKHARF------------QPV-C-------------------
Q6RK98_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A7D6TSN5_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
Q71BY5_E1B19K-02          ----------------------------------------------PVSE
Q71BY5_E1B19K-04          LLLLSS-VRPA--I------------IPT-E-------------------
A0A1U9ALK7_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A4P2SGW2_E1B19K-02      CRPCEC-GGKHIRN------------QPV-M-------------------
P03246_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
Q6WQ37_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
E1U5L6_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
E1U5L6_E1B19K-03          CRPCEC-GGKHIRN------------QPV-M-------------------
F1DT57_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
F1DT57_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0A1P7YWR9_E1B19K-01      ILNYWL-LQPAAS-------------GLL-H-------------------
A0A1P7YWR9_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A1P7YWY2_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A1P7YWY2_E1B19K-01      ILNYWL-LQPAAS-------------GLL-H-------------------
A0A1P7YXN8_E1B19K-01      ILNYWL-LQPAAS-------------GLL-H-------------------
A0A1P7YYY5_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A1P7YYY5_E1B19K-01      ILNYWL-LQPAAS-------------GLL-H-------------------
A0A1P8C849_E1B19K-01      ILNYWL-LQPAAL-------------GLL-H-------------------
B9A5A7_E1B19K-01          ILNYWL-LQPAAS-------------GLL-H-------------------
M0QU02_E1B19K-01          ILNYWL-LQPAAP-------------GLL-H-------------------
A0A3G8W6L2_E1B19K-01      ISGYLP-VQPLDTL------------RIL-S-------------------
Q2KSG6_E1B19K-02          ICRYS---------------------------------------------
Q2KSG6_E1B19K-04          CRACEC-GGKHARF------------QPV-C-------------------
Q2KSG6_E1B19K-03          CRACEC-GGKHARF------------QPV-C-------------------
Q5GFC7_E1B19K-02          I-------------------------------------------------
A0A142G3J2_E1B19K-01      VLGCLP-AQRPHGL------------DPV-Q-------------------
P10543_E1B19K-01          VLGCLP-AQRPHGL------------DPV-Q-------------------
A0A1S6ELT2_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A3G8W407_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A482EVC6_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A7U3RWV6_E1B19K-01      VLGCSP-AQPPHGL------------DPT-V-------------------
A0A898KBS1_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A513TZR1_E1B19K-01      MLLLSS-VRPA--I------------IPT-E-------------------
A0A516UYM9_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A0K0PX35_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A0K0PX99_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A6M6AA96_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
I6LEP5_E1B19K-03          VRACEC-GGKHARF------------QPV-C-------------------
I6LEP5_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
J7ID56_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
T1UE63_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UF50_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
T1UIP3_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UJX4_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
T1UJX4_E1B19K-02          VRTCEC-GGKHARF------------QPV-C-------------------
A0A291P1B2_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A3Q9HJZ5_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A3Q9HLF7_E1B19K-01      LLLLSS-VSPA--I------------IPT-E-------------------
A0A3S9SNH4_E1B19K-01      MLLLSS-VRPA--I------------IPT-E-------------------
A0A3S9SNY0_E1B19K-01      LLLLSS-VSPA--I------------IPT-E-------------------
A0A3S9SP19_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A3S9SSS2_E1B19K-01      LLLLSS-VRPA---------------IPT-E-------------------
A0A6M4W5T4_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A7D0TN91_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A7L4WGT1_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A7L4WIC2_E1B19K-01      LILLSS-VRPA--I------------IPT-E-------------------
A0A7L4WIG2_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A7L4WK62_E1B19K-01      MLLLSS-VRPA--I------------IRT-E-------------------
A0A8F9W8V2_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
E1ARN8_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
J7I6T8_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
J9Z4N4_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
T1UG63_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
A0A075TSZ1_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
A0A097I4T0_E1B19K-01      ILNYWL-IQPAAP-------------GLL-R-------------------
A0A097I4T0_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A0G2UY10_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
A0A0G2UY10_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A1J0MS84_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
A0A291B0H2_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
A0A384ZUF2_E1B19K-01      ILNYWL-LQPAAP-------------VLL-R-------------------
A0A384ZUM9_E1B19K-01      ILSYWL-LQPAAP-------------GLL-R-------------------
A0A384ZUM9_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
F8UFP5_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
F8UFP5_E1B19K-01          ILNYWL-LQPAAP-------------GLL-H-------------------
G3CK71_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
G3CK71_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UG22_E1B19K-02          VRACEC-GGRHSRM------------QPV-A-------------------
T1UGT5_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UGT5_E1B19K-01          ILNYWL-LQPAVP-------------GLL-R-------------------
T1UGU0_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UGX3_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UGX3_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UGY3_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UHG3_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UHG3_E1B19K-01          ILNYWL-LQPAAP-------------GLL-C-------------------
T1UHH6_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UHH6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UHQ8_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UHQ8_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UHZ2_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UK99_E1B19K-01          ILNYWL-LQPAAP-------------GLL-H-------------------
T1UK99_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UKP8_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UKQ0_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UKQ0_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UKV6_E1B19K-01          ILNYWL-LQPAVP-------------GLL-R-------------------
T1UKV6_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1ULJ8_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1ULJ8_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1ULP4_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
X4Y9D2_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
A0A0A1EUB2_E1B19K-01      VCIYLR-AQPP--R------------LGRVE-------------------
A0A0A1EUC8_E1B19K-01      VCIYLR-AQPP--R------------LDRVE-------------------
A0A0A1EUE4_E1B19K-01      VCIYSR-AQPP--R------------LDRVV-------------------
A0A2H5AI21_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AI40_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AI99_E1B19K-01      VCIYLR-AQPP--R------------LDRVE-------------------
A0A2H5AID8_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A0M3TH18_E1B19K-01      IYTFSQ--GPR--S------------LPQ-R-------------------
A0A2H4CJZ0_E1B19K-01      VSGFSP-ARPPHGL------------DPV-L-------------------
H8PFZ1_E1B19K-01          VSGFSP-ARPPHGL------------DPV-L-------------------
A0A0M3TH31_E1B19K-01      ACIYLP-VQPQRGL------------ERV-E-------------------
Q6QPF3_E1B19K-01          ISGYLP-VQPVDTL------------RIL-S-------------------
A0A9W3HRK4_E1B19K-01      LYGRLVERHPS--L------------RQQ-R-------------------
F2WTJ7_E1B19K-01          VYNYSR-GLPPLGR------------ASL-P-------------------
A0A9W3INM3_E1B19K-01      LYGRLVERHPS--L------------RQQ-R-------------------
H9AA76_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
H9AAD9_E1B19K-01          VYNYSR-GLPPLGL------------ASV-A-------------------
H9AAH3_E1B19K-01          VYNYSR-GLPPLGL------------ASV-A-------------------
H9AAK5_E1B19K-01          VYNYSR-GLPPLGL------------ASV-A-------------------
H9AAN8_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
M9YVA3_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
Q6QPI9_E1B19K-01          ISGYLP-VQPVDTL------------RIL-S-------------------
Q8B6X5_E1B19K-01          VYNYSR-GLPQLGP------------VAP-L-------------------
B5SNR1_E1B19K-01          VLGCSP-AQPPHGL------------DPV-R-------------------
A0A1L7NRH1_E1B19K-01      ILGYWP-VQPLGVA------------GIL---------------------
Q5UW22_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
J7H4R9_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
D2DM83_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
A0A7U3S224_E1B19K-01      ILGYWP-VQPLGVA------------GIL---------------------
J7I6W7_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
J7I6W7_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
M0QUB4_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
C4P207_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
D4N3H6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QVK6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QVT4_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
A0A3G8WIY5_E1B19K-01      ILNYWL-LQPAAP-------------GLL-R-------------------
T1ULP4_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
A0A7R6T9I9_E1B19K-01      ILNYWL-IQPAAP-------------GLL-R-------------------
B6C6W8_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
B9A681_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
A0A1Y1BYF1_E1B19K-01      ILNYWL-IQPAAP-------------GLL-R-------------------
T1UHZ2_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QU41_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0A075IQ70_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
A0A075IQ70_E1B19K-02      VRACEC-GGKHARF------------QPV-C-------------------
K7NG43_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q2KRU2_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
T1UIP3_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
A0A3S6PYX7_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
G1FC01_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E5RWL1_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QU41_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
B2VQE3_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
B6DU90_E1B19K-01          ILNYWL-IQPAAP-------------GLL-R-------------------
M0QUN2_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E1CIM6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E1AI10_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
H0PPE7_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
Q9YL99_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
K7ZLN6_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E1CIR1_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E1AI10_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
A0A384ZUF2_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
R4HLA0_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q2KSL3_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
A0A5J6CTQ0_E1B19K-01      ILDYWP-VQPLGVA------------GIL---------------------
I6LES1_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
Q2KSL3_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
I6LEP5_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
I6LES1_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UF50_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
M0QV08_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
G9JUV5_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
M0QV08_E1B19K-02          VRACEC-GGRHTRM------------QPV-A-------------------
T1UFS4_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
T1UFS4_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
X4YVU5_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
E1CIJ0_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
T1UGU0_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
Q2KSM8_E1B19K-02          I-------------------------------------------------
A0A2R3WNP3_E1B19K-01      I-------------------------------------------------
Q2KSG6_E1B19K-01          ISGYLP-VQPLDTL------------RIL-S-------------------
Q5GFC7_E1B19K-01          ISGYLP-VQPLDTL------------RIL-S-------------------
Q5GFC8_E1B19K-01          ISGYLP-VQPLDTL------------RIL-S-------------------
Q6H1D7_E1B19K-01          ISGYLP-VQPLDTL------------RIL-S-------------------
T1UGY3_E1B19K-01          ILNYWL-LQPAAS-------------GLL-H-------------------
A0A7U3S1T6_E1B19K-01      ILGYWP-VQPLGVA------------GIL---------------------
J7ID56_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UKP8_E1B19K-01          ILNYWL-LQPAAP-------------GLL-R-------------------
A0A075TSZ1_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A897JQR0_E1B19K-01      ILNYWP-VQPLGVA------------GIL---------------------
I1V161_E1B19K-01          ILNYWP-VQPLGVA------------GIL---------------------
A0A5P8KYF0_E1B19K-01      ILNYWP-VQPLGVA------------GIL---------------------
J7I6S4_E1B19K-01          ILNYWP-VQPLGVA------------GIL---------------------
A0A897JQR0_E1B19K-02      VRACEC-GGKHARF------------QPV-C-------------------
I1V161_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A5P8KYF0_E1B19K-02      VRACEC-GGKHARF------------QPV-C-------------------
J7I6S4_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
T1UEX7_E1B19K-01          VCIYSL-ARPL--T------------MPPLQ-------------------
T1UE63_E1B19K-01          ILGYWP-VQPLGVA------------GIL---------------------
Q6RK98_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
J7I6Q4_E1B19K-01          ILDYWP-VQPLGVA------------GIL---------------------
J7I6Q4_E1B19K-02          VRACEC-GGKHARF------------QPV-C-------------------
A0A4P2SGW2_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
E1ARN8_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
A0A6M5E4Y6_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
P03247_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
A0A3G8W3H5_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
E1U5L6_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
A0A516UYI9_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
J9Z5H0_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
Q6VGV8_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
A0A0G2R248_E1B19K-01      LLLLSS-VRPA--I------------IPT-E-------------------
A0A0G2R248_E1B19K-02      CRPCEC-GGKHIRN------------QPV-M-------------------
J9Z5H0_E1B19K-02          CRPCEC-GGKHIRN------------QPV-M-------------------
A0A1P7YXN8_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
A0A1P8C849_E1B19K-02      VRACEC-GGRHTRM------------QPV-A-------------------
T1UG22_E1B19K-01          ILNYWL-LQPAAS-------------GLL-H-------------------
A0A2L1F392_E1B19K-01      ICRYS---------------------------------------------
A0A2R3WN16_E1B19K-01      ISGYLP-VQPLDTL------------RIL-S-------------------
A0A2R3WN62_E1B19K-01      I-------------------------------------------------
Q6H1D7_E1B19K-02          CRACEC-GGKHARF------------QPV-C-------------------
A0A6M6AEV2_E1B19K-01      VLGCLP-AQRPHGL------------DPV-Q-------------------
A0A6M6AES6_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A9X9P8C6_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
A0A6B9DS29_E1B19K-01      VLGCSP-AQPPHGL------------DPV-R-------------------
W0S1G8_E1B19K-01          VLGCSP-AQPPHGL------------DPV-R-------------------
J9Z4H6_E1B19K-01          LLLLSS-VRPA--I------------IPT-E-------------------
I6LES1_E1B19K-03          VRACEC-GGKHARF------------QPV-C-------------------
A0A2H5AI04_E1B19K-01      VCIYLR-AQPP--R------------LDRVE-------------------
A0A2H5AI72_E1B19K-01      VCIYLR-AQPP--R------------LDRVE-------------------
A0A2H5AIL3_E1B19K-01      VCIYLR-AQPP--R------------LDRVE-------------------
A0A0M5L3Y4_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
Q5C8R2_E1B19K-01          VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AII9_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AIN5_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AIU0_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AIL0_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AIS9_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
A0A2H5AIT6_E1B19K-01      VCIYLR-AQPP--R------------LDRVV-------------------
M9YXY5_E1B19K-01          ACIYLP-VQPQRGL------------ERV-E-------------------
H9AAS0_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
H9AAV3_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
H9AAY5_E1B19K-01          VYNYSR-GLPPLGR------------ASS-P-------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      ---------------------QTS--------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          PEPEPEPEPEPARPARRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNT
Q71BY5_E1B19K-03          --------------------LPGVLK------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          PEPEPEPEPEPARPARRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNT
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------G-----ELSQ-----------Q--------
Q6RK98_E1B19K-03          --------------------G-----ELSK-----------Q--------
P04492_E1B19K-02          --------------------------LNVT-----------E-EL-R---
Q2KSM8_E1B19K-01          --------------------------LQQI---------SQE-RQ-R---
M9YVF6_E1B19K-01          --------------------------E-----------------------
T2CI10_E1B19K-01          ----------------------------------------------RHP-
A0A1W5PVU4_E1B19K-01      --------------------------VRRRLG------FQTE--------
A0A3Q9HK00_E1B19K-01      --------------------------EQQQQQ-----QQQQE-EA-R---
A0A9X9PKC1_E1B19K-01      --------------------------EEEE--------------------
A0A5K6WAR5_E1B19K-01      --------------------------EQQQ---------QQE-EA-R---
T2CI10_E1B19K-02          --------------------------VDVT-----------E-EL-R---
A0A2H5AIC5_E1B19K-01      --------------------------EENE--------------------
A0A0M4N3Z1_E1B19K-01      --------------------------VRQGSQ------QEEQQQQ-R---
A0A3S9SPV1_E1B19K-01      --------------------------EQQQQQQQQQQQQQQE-EA-R---
A0A9W3HRK4_E1B19K-02      --------------------------GMVT-----------E-EV-R---
A0A7L4WJT1_E1B19K-01      --------------------------EQQQQQQ--QQQQQQE-EA-R---
D3JIR7_E1B19K-02          --------------------------LNVT-----------E-EL-R---
Q2KSM8_E1B19K-03          --------------------------VDVT-----------E-DL-R---
A0A7U3RVU4_E1B19K-01      --------------------------EEE---------------------
F2WTM9_E1B19K-01          --------------------------EEQSPE------VKPK-VA-G---
A0A0M4NHE0_E1B19K-01      --------------------------EERSEE-------SKP-EV-N---
A0A2H4PJ75_E1B19K-01      --------------------------EQQQQ--------QQE-EA-R---
G0ZAH2_E1B19K-01          --------------------------RELEE-------RERE-RQ-Q---
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------LDVT-----------E-EL-R---
J9Z4H6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
P04492_E1B19K-01          --------------------------TLQE---------E----------
A0A898KBW7_E1B19K-01      --------------------------EEEEEE------------------
A0A7L4WG90_E1B19K-01      --------------------------EQQQQQQ---QQQQQE-EA-R---
A0A3S9SND6_E1B19K-01      --------------------------EQQQQ-------QQQE-EA-R---
J7I6T8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A5H2QAX5_E1B19K-01      --------------------------EEQ---------------------
Q6QPB7_E1B19K-01          --------------------------LQ-S---------PQE-HQ-RRQQ
A0A8G1GLF6_E1B19K-01      --------------------------E-----------------------
T1UG63_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A3Q9HJ63_E1B19K-01      --------------------------EQQQQQQ----QQQQE-EA-R---
T1UEX7_E1B19K-02          --------------------------LNVT-----------E-EL-R---
F6KST6_E1B19K-01          --------------------------LQAQ-----------A-LL-R---
A0A482EVC6_E1B19K-02      --------------------------LNVT-----------E-QL-R---
A0A3Q9HK78_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
H9AAA8_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
A0MK43_E1B19K-02          --------------------------LNVT-----------E-EL-R---
Q32UI6_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A3S6PYX7_E1B19K-01      --------------------------LH-------------------RQ-
Q5GFC7_E1B19K-03          --------------------------VDVT-----------E-DL-R---
A0A3Q9HJ54_E1B19K-01      --------------------------EQQQ-----------E-EARR---
A0A898KBR0_E1B19K-01      --------------------------EE----------------------
J9Z4N4_E1B19K-01          --------------------------EQQQ---------QQE-EA-R---
P10544_E1B19K-01          --------------------------EEE---------------------
F4ZCJ8_E1B19K-01          --------------------------EEEEE-------------------
Q8UY91_E1B19K-01          --------------------------LQES---------PRA-RQ-RRQ-
A0A9W3I4N3_E1B19K-01      --------------------------LQAQ-----------V-LL-R---
A0A1L3INW0_E1B19K-01      --------------------------VRAQ-----------V-LS-R---
A0A097IW62_E1B19K-01      --------------------------LRRRLG------MPTD--------
A0A3G4W995_E1B19K-01      --------------------------EE----------------------
A0A7D0TLU2_E1B19K-01      --------------------------WPPQ-----------N-HP-W---
G9G841_E1B19K-01          --------------------------LQES---------PRA-RQ-RRR-
Q6VGV8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
P06501_E1B19K-01          --------------------------ARQGSQ------QEEQ-QQ-R---
Q71BY5_E1B19K-01          PPEIHPVVPLCPIKPVAVRVGGRRRAVECI-----------E-DL-L---
Q71BY5_E1B19K-03          ---------WCL--------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------LDVT-----------E-EL-R---
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------VDVT-----------E-DL-R---
Q5GFC7_E1B19K-04          --------------------------VDVT-----------E-DL-R---
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------EEQLPE------VKPE-VA-G---
W6EIX6_E1B19K-01          ----------------------------------------------RHP-
W6EIX6_E1B19K-02          --------------------------VDVT-----------E-DL-R---
Q7T8D8_E1B19K-01          ----------------------------------------------RHP-
Q7T8D8_E1B19K-02          --------------------------VDVT-----------E-DL-R---
Q8B8U7_E1B19K-01          ----------------------------------------------RHP-
Q32UI6_E1B19K-01          ----------------------------------------------RHP-
B9A5Q1_E1B19K-01          --------------------------LH-------------------RQ-
B9A5T7_E1B19K-01          --------------------------LH-------------------RQ-
M0QU76_E1B19K-01          --------------------------LH-------------------RQ-
M0QU76_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A0B4SJH1_E1B19K-01      ----------------------------------------------RHP-
A0A0B4SJH1_E1B19K-02      --------------------------VDVT-----------E-DL-R---
Q2KS85_E1B19K-01          ----------------------------------------------RHP-
Q2KS85_E1B19K-02          --------------------------VDVT-----------E-DL-R---
C5HDR2_E1B19K-01          --------------------------LH-------------------RQ-
C5HDR2_E1B19K-02          --------------------------LDVT-----------E-EL-R---
D3GBW3_E1B19K-01          --------------------------LH-------------------RQ-
M0QUB4_E1B19K-02          --------------------------LDVT-----------E-EL-R---
W8CZB0_E1B19K-01          --------------------------LH-------------------RQ-
W8CZB0_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QUF3_E1B19K-01          --------------------------LH-------------------RQ-
M0QUF3_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QUJ3_E1B19K-01          --------------------------LH-------------------RQ-
M0QUJ3_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QUN2_E1B19K-02          --------------------------LDVT-----------E-EL-R---
C4P207_E1B19K-02          --------------------------LDVT-----------E-EL-R---
R4HLJ6_E1B19K-01          ----------------------------------------------RHP-
R4HLJ6_E1B19K-02          --------------------------VDVT-----------E-DL-R---
M0QTS5_E1B19K-01          --------------------------LH-------------------RQ-
M0QTS5_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QUS9_E1B19K-01          --------------------------LH-------------------RQ-
M0QUS9_E1B19K-02          --------------------------LDVT-----------E-EL-R---
Q3ZL02_E1B19K-01          ----------------------------------------------RHP-
Q3ZL02_E1B19K-02          --------------------------VDVT-----------E-DL-R---
M0QV47_E1B19K-01          --------------------------LH-------------------RQ-
M0QV47_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QV87_E1B19K-01          --------------------------LH-------------------RQ-
M0QV87_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QVC7_E1B19K-01          --------------------------LH-------------------RQ-
M0QVC7_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QVG6_E1B19K-01          --------------------------LH-------------------RQ-
M0QVG6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QVK6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
M0QVP5_E1B19K-01          --------------------------LH-------------------RQ-
M0QVP5_E1B19K-02          --------------------------LDVT-----------E-EL-R---
Q4KSL0_E1B19K-01          --------------------------LH-------------------RQ-
M0QUW8_E1B19K-01          --------------------------LH-------------------RQ-
M0QUW8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------LQQI---------SQE-RQ-R---
A0A3G9CMQ4_E1B19K-01      --------------------------LQ----------------------
Q3ZKW2_E1B19K-01          ----------------------------------------------RHP-
Q3ZKW2_E1B19K-02          --------------------------VDVT-----------E-DL-R---
M0QVT4_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0MK43_E1B19K-01          --------------------------EENE--------------------
A0A3Q9FFS0_E1B19K-01      --------------------------LH-------------------RQ-
A0A3Q9FFS0_E1B19K-02      --------------------------LDVT-----------E-EL-R---
E5RWD9_E1B19K-01          --------------------------LH-------------------RQ-
B9A5L5_E1B19K-01          --------------------------LH-------------------RQ-
A0A7G5F9T0_E1B19K-01      ----------------------------------------------RHL-
A0A7G5FB98_E1B19K-01      ----------------------------------------------RHP-
A0A7G5FB98_E1B19K-02      --------------------------VDVT-----------E-DL-R---
C7SRS7_E1B19K-01          ----------------------------------------------RHP-
A0A1Y1BXT7_E1B19K-01      --------------------------LH-------------------RQ-
E9P585_E1B19K-01          --------------------------LH-------------------RQ-
E9P585_E1B19K-02          --------------------------LDVT-----------E-EL-R---
G1FC01_E1B19K-02          --------------------------LDVT-----------E-EL-R---
G1DE13_E1B19K-01          --------------------------EEQ---------------------
G1FBW4_E1B19K-01          --------------------------LH-------------------RQ-
G1FBW4_E1B19K-02          --------------------------LDVT-----------E-EL-R---
R4HLA0_E1B19K-02          --------------------------VDVT-----------E-DL-R---
H5T740_E1B19K-01          --------------------------LH-------------------RQ-
K7NG43_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UHL7_E1B19K-01          --------------------------LH-------------------RQ-
T1UHL7_E1B19K-02          --------------------------LDVT-----------E-EL-R---
R4HMC6_E1B19K-01          ----------------------------------------------RHP-
R4HMC6_E1B19K-02          --------------------------VDVT-----------E-DL-R---
W8VNG2_E1B19K-01          --------------------------LH-------------------RQ-
A0A3G8WH01_E1B19K-01      --------------------------TLQE---------E----------
D3JIR7_E1B19K-01          --------------------------TLQE---------E----------
A0A5H2QAX5_E1B19K-02      --------------------------LNVT-----------E-EL-R---
D0Z5R9_E1B19K-01          --------------------------EEQ---------------------
Q2KRU2_E1B19K-02          --------------------------VDVT-----------E-DL-R---
R4HLE1_E1B19K-01          ----------------------------------------------RHP-
R4HLE1_E1B19K-02          --------------------------VDVT-----------E-DL-R---
Q7T951_E1B19K-01          ----------------------------------------------RHP-
A0A8B0L9Y2_E1B19K-01      ----------------------------------------------RHP-
A0A8B0LBX6_E1B19K-01      ----------------------------------------------RHP-
A0A8B0LCV0_E1B19K-01      ----------------------------------------------RHP-
A0A8B0LD36_E1B19K-01      ----------------------------------------------RHP-
Q2Y0J3_E1B19K-01          ----------------------------------------------RHP-
Q2Y0J3_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A220VZ73_E1B19K-01      ----------------------------------------------RHP-
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ----------------------------------------------RHP-
Q5EY83_E1B19K-01          ----------------------------------------------RHP-
Q5EY83_E1B19K-02          --------------------------VDVT-----------E-DL-R---
Q5EY83_E1B19K-03          --------------------------VDVT-----------E-DL-R---
Q6RK98_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A7D6TSN5_E1B19K-01      --------------------------EQQQQQQ----QQQEE-AR-R---
Q71BY5_E1B19K-02          PPEIHPVVPLCPIKPVAVRVGGRRRAVECI-----------E-DL-L---
Q71BY5_E1B19K-04          --------------------------EQQQQQ------QQQE-EA-R---
A0A1U9ALK7_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
A0A4P2SGW2_E1B19K-02      --------------------------LDVT-----------E-EL-R---
P03246_E1B19K-01          --------------------------EQQQ---------QQE-EA-R---
Q6WQ37_E1B19K-01          --------------------------EQQQ---------QQE-EA-R---
E1U5L6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
E1U5L6_E1B19K-03          --------------------------LDVT-----------E-EL-R---
F1DT57_E1B19K-01          --------------------------LH-------------------RQ-
F1DT57_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A1P7YWR9_E1B19K-01      --------------------------LH-------------------RQ-
A0A1P7YWR9_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A1P7YWY2_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A1P7YWY2_E1B19K-01      --------------------------LH-------------------RQ-
A0A1P7YXN8_E1B19K-01      --------------------------LH-------------------RQ-
A0A1P7YYY5_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A1P7YYY5_E1B19K-01      --------------------------LH-------------------RQ-
A0A1P8C849_E1B19K-01      --------------------------LH-------------------RQ-
B9A5A7_E1B19K-01          --------------------------LH-------------------RQ-
M0QU02_E1B19K-01          --------------------------LH-------------------RQ-
A0A3G8W6L2_E1B19K-01      --------------------------LQQI---------SQE-RQ-R---
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------VNVT-----------E-DL-R---
Q2KSG6_E1B19K-03          --------------------------VNVT-----------E-DL-R---
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------EE----------------------
P10543_E1B19K-01          --------------------------EE----------------------
A0A1S6ELT2_E1B19K-01      --------------------------EEEE--------------------
A0A3G8W407_E1B19K-01      --------------------------EE----------------------
A0A482EVC6_E1B19K-01      --------------------------EEEE--------------------
A0A7U3RWV6_E1B19K-01      --------------------------REE---------------------
A0A898KBS1_E1B19K-01      --------------------------EEE---------------------
A0A513TZR1_E1B19K-01      --------------------------EQQQQQ-----QQQQE-EA-R---
A0A516UYM9_E1B19K-01      --------------------------EQQQQQ-----QQQQE-EA-R---
A0A0K0PX35_E1B19K-01      ----------------------------------------------RHP-
A0A0K0PX99_E1B19K-01      ----------------------------------------------RHP-
A0A6M6AA96_E1B19K-01      ----------------------------------------------RHP-
I6LEP5_E1B19K-03          --------------------------VDVT-----------E-DL-R---
I6LEP5_E1B19K-01          ----------------------------------------------RHP-
J7ID56_E1B19K-01          ----------------------------------------------RHP-
T1UE63_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UF50_E1B19K-01          ----------------------------------------------RHP-
T1UIP3_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UJX4_E1B19K-01          ----------------------------------------------RHP-
T1UJX4_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A291P1B2_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
A0A3Q9HJZ5_E1B19K-01      --------------------------EQQQQQ-----QQQQE-EA-R---
A0A3Q9HLF7_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
A0A3S9SNH4_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
A0A3S9SNY0_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
A0A3S9SP19_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
A0A3S9SSS2_E1B19K-01      --------------------------EQQQQQ-----QQQQE-EA-R---
A0A6M4W5T4_E1B19K-01      --------------------------EQQQQ-------QQQE-ET-R---
A0A7D0TN91_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
A0A7L4WGT1_E1B19K-01      --------------------------E----------------EA-R---
A0A7L4WIC2_E1B19K-01      --------------------------QQQQQQQ----QQQQE-EA-R---
A0A7L4WIG2_E1B19K-01      --------------------------EQQQQ-------QLQE-EA-R---
A0A7L4WK62_E1B19K-01      --------------------------EQQQQ--------QQE-EA-R---
A0A8F9W8V2_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
E1ARN8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
J7I6T8_E1B19K-01          --------------------------EQQQQ-------QQQE-EA-R---
J9Z4N4_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UG63_E1B19K-01          --------------------------EQQQQQ-----QQQEE-AR-R---
A0A075TSZ1_E1B19K-01      --------------------------LH-------------------RQ-
A0A097I4T0_E1B19K-01      --------------------------LH-------------------RQ-
A0A097I4T0_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A0G2UY10_E1B19K-01      --------------------------LH-------------------RQ-
A0A0G2UY10_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A1J0MS84_E1B19K-01      --------------------------LH-------------------RQ-
A0A291B0H2_E1B19K-01      --------------------------LH-------------------RQ-
A0A384ZUF2_E1B19K-01      --------------------------LH-------------------RQ-
A0A384ZUM9_E1B19K-01      --------------------------LH-------------------RQ-
A0A384ZUM9_E1B19K-02      --------------------------LDVT-----------E-EL-R---
F8UFP5_E1B19K-02          --------------------------LDVT-----------E-DL-R---
F8UFP5_E1B19K-01          --------------------------LH-------------------RQ-
G3CK71_E1B19K-02          --------------------------LDVT-----------E-EL-R---
G3CK71_E1B19K-01          --------------------------LH-------------------RQ-
T1UG22_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UGT5_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UGT5_E1B19K-01          --------------------------LH-------------------RQ-
T1UGU0_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UGX3_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UGX3_E1B19K-01          --------------------------LH-------------------RQ-
T1UGY3_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UHG3_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UHG3_E1B19K-01          --------------------------LH-------------------RQ-
T1UHH6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UHH6_E1B19K-01          --------------------------LH-------------------RQ-
T1UHQ8_E1B19K-01          --------------------------LH-------------------RQ-
T1UHQ8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UHZ2_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UK99_E1B19K-01          --------------------------LH-------------------RQ-
T1UK99_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UKP8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UKQ0_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UKQ0_E1B19K-01          --------------------------LH-------------------RQ-
T1UKV6_E1B19K-01          --------------------------LH-------------------RQ-
T1UKV6_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1ULJ8_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1ULJ8_E1B19K-01          --------------------------LH-------------------RQ-
T1ULP4_E1B19K-02          --------------------------LDVT-----------E-EL-R---
X4Y9D2_E1B19K-01          --------------------------LH-------------------RQ-
A0A0A1EUB2_E1B19K-01      --------------------------EEDE--------------------
A0A0A1EUC8_E1B19K-01      --------------------------EEDE--------------------
A0A0A1EUE4_E1B19K-01      --------------------------EEDE--------------------
A0A2H5AI21_E1B19K-01      --------------------------EENE--------------------
A0A2H5AI40_E1B19K-01      --------------------------EENE--------------------
A0A2H5AI99_E1B19K-01      --------------------------EEDE--------------------
A0A2H5AID8_E1B19K-01      --------------------------EENE--------------------
A0A0M3TH18_E1B19K-01      --------------------------VRRRLG------FKTE--------
A0A2H4CJZ0_E1B19K-01      --------------------------EEP---------------------
H8PFZ1_E1B19K-01          --------------------------EES---------------------
A0A0M3TH31_E1B19K-01      --------------------------EE----------------------
Q6QPF3_E1B19K-01          --------------------------LQ-S---------PQE-HQ-RRQQ
A0A9W3HRK4_E1B19K-01      --------------------------LQAQ-----------V-LL-R---
F2WTJ7_E1B19K-01          --------------------------EEQSPE------VKPK-VA-G---
A0A9W3INM3_E1B19K-01      --------------------------LQAQ-----------V-LL-R---
H9AA76_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
H9AAD9_E1B19K-01          --------------------------EERSEE-------SKP-EV-N---
H9AAH3_E1B19K-01          --------------------------EERSEE-------SKP-EV-N---
H9AAK5_E1B19K-01          --------------------------EERSEE-------SKP-EV-N---
H9AAN8_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
M9YVA3_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
Q6QPI9_E1B19K-01          --------------------------LQ-S---------PQE-HQ-RRQQ
Q8B6X5_E1B19K-01          --------------------------VRQGSQ------QEEQQQQ-R---
B5SNR1_E1B19K-01          --------------------------EEEE--------------------
A0A1L7NRH1_E1B19K-01      ----------------------------------------------RHP-
Q5UW22_E1B19K-01          ----------------------------------------------RHP-
J7H4R9_E1B19K-01          ----------------------------------------------RHP-
D2DM83_E1B19K-01          ----------------------------------------------RHP-
A0A7U3S224_E1B19K-01      ----------------------------------------------RHP-
J7I6W7_E1B19K-01          ----------------------------------------------RHP-
J7I6W7_E1B19K-02          --------------------------VDVT-----------E-DL-R---
M0QUB4_E1B19K-01          --------------------------LH-------------------RQ-
C4P207_E1B19K-01          --------------------------LH-------------------RQ-
D4N3H6_E1B19K-01          --------------------------LH-------------------RQ-
M0QVK6_E1B19K-01          --------------------------LH-------------------RQ-
M0QVT4_E1B19K-01          --------------------------LH-------------------RQ-
A0A3G8WIY5_E1B19K-01      --------------------------LH-------------------RQ-
T1ULP4_E1B19K-01          --------------------------LH-------------------RQ-
A0A7R6T9I9_E1B19K-01      --------------------------LH-------------------RQ-
B6C6W8_E1B19K-01          --------------------------LH-------------------RQ-
B9A681_E1B19K-01          --------------------------LH-------------------RQ-
A0A1Y1BYF1_E1B19K-01      --------------------------LH-------------------RQ-
T1UHZ2_E1B19K-01          --------------------------LH-------------------RQ-
M0QU41_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A075IQ70_E1B19K-01      ----------------------------------------------RHP-
A0A075IQ70_E1B19K-02      --------------------------VDVT-----------E-DL-R---
K7NG43_E1B19K-01          ----------------------------------------------RHP-
Q2KRU2_E1B19K-01          ----------------------------------------------RHP-
T1UIP3_E1B19K-01          ----------------------------------------------RHP-
A0A3S6PYX7_E1B19K-02      --------------------------LDVT-----------E-EL-R---
G1FC01_E1B19K-01          --------------------------LH-------------------RQ-
E5RWL1_E1B19K-01          --------------------------LH-------------------RQ-
M0QU41_E1B19K-01          --------------------------LH-------------------RQ-
B2VQE3_E1B19K-01          --------------------------LH-------------------RQ-
B6DU90_E1B19K-01          --------------------------LH-------------------RQ-
M0QUN2_E1B19K-01          --------------------------LH-------------------RQ-
E1CIM6_E1B19K-01          --------------------------LH-------------------RQ-
E1AI10_E1B19K-01          --------------------------LH-------------------RQ-
H0PPE7_E1B19K-01          --------------------------LH-------------------RQ-
Q9YL99_E1B19K-01          --------------------------LH-------------------RQ-
K7ZLN6_E1B19K-01          --------------------------LH-------------------RQ-
E1CIR1_E1B19K-01          --------------------------LH-------------------RQ-
E1AI10_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A384ZUF2_E1B19K-02      --------------------------LDVT-----------E-EL-R---
R4HLA0_E1B19K-01          ----------------------------------------------RHP-
Q2KSL3_E1B19K-01          ----------------------------------------------RHP-
A0A5J6CTQ0_E1B19K-01      ----------------------------------------------RHP-
I6LES1_E1B19K-01          ----------------------------------------------RHP-
Q2KSL3_E1B19K-02          --------------------------VDVT-----------E-DL-R---
I6LEP5_E1B19K-02          --------------------------VDVT-----------E-DL-R---
I6LES1_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UF50_E1B19K-02          --------------------------VDVT-----------E-DL-R---
M0QV08_E1B19K-01          --------------------------LH-------------------RQ-
G9JUV5_E1B19K-01          --------------------------LH-------------------RQ-
M0QV08_E1B19K-02          --------------------------LDVT-----------E-EL-R---
T1UFS4_E1B19K-01          ----------------------------------------------RHP-
T1UFS4_E1B19K-02          --------------------------VDVT-----------E-DL-R---
X4YVU5_E1B19K-01          --------------------------LH-------------------RQ-
E1CIJ0_E1B19K-01          --------------------------LH-------------------RQ-
T1UGU0_E1B19K-01          --------------------------LH-------------------RQ-
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------LQQI---------SQE-RQ-R---
Q5GFC7_E1B19K-01          --------------------------LQ----------------------
Q5GFC8_E1B19K-01          --------------------------LQ----------------------
Q6H1D7_E1B19K-01          --------------------------LQ----------------------
T1UGY3_E1B19K-01          --------------------------LH-------------------RQ-
A0A7U3S1T6_E1B19K-01      ----------------------------------------------RHP-
J7ID56_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UKP8_E1B19K-01          --------------------------LH-------------------RQ-
A0A075TSZ1_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A897JQR0_E1B19K-01      ----------------------------------------------RHP-
I1V161_E1B19K-01          ----------------------------------------------RHP-
A0A5P8KYF0_E1B19K-01      ----------------------------------------------RHP-
J7I6S4_E1B19K-01          ----------------------------------------------RHP-
A0A897JQR0_E1B19K-02      --------------------------VDVT-----------E-DL-R---
I1V161_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A5P8KYF0_E1B19K-02      --------------------------VDVT-----------E-DL-R---
J7I6S4_E1B19K-02          --------------------------VDVT-----------E-DL-R---
T1UEX7_E1B19K-01          --------------------------EEQ---------------------
T1UE63_E1B19K-01          ----------------------------------------------RHP-
Q6RK98_E1B19K-01          ----------------------------------------------RHP-
J7I6Q4_E1B19K-01          ----------------------------------------------RHP-
J7I6Q4_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A4P2SGW2_E1B19K-01      --------------------------EQQQQQ------QQQE-EA-R---
E1ARN8_E1B19K-01          --------------------------EQQQQQ------QQQE-EA-R---
A0A6M5E4Y6_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
P03247_E1B19K-01          --------------------------EQQ-----------QE-EA-R---
A0A3G8W3H5_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
E1U5L6_E1B19K-01          --------------------------EQQ-----------QE-EA-R---
A0A516UYI9_E1B19K-01      --------------------------EQQ-----------QE-EA-R---
J9Z5H0_E1B19K-01          --------------------------EQQ-----------QE-EA-R---
Q6VGV8_E1B19K-01          --------------------------EQQQ---------QQE-EA-R---
A0A0G2R248_E1B19K-01      --------------------------EQQQ---------QQE-EA-R---
A0A0G2R248_E1B19K-02      --------------------------LDVT-----------E-EL-R---
J9Z5H0_E1B19K-02          --------------------------LDVT-----------E-EL-R---
A0A1P7YXN8_E1B19K-02      --------------------------LDVT-----------E-EL-R---
A0A1P8C849_E1B19K-02      --------------------------LDVT-----------E-EL-R---
T1UG22_E1B19K-01          --------------------------LH-------------------RQ-
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------LQQI---------SQE-RQ-R---
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------VDVT-----------E-DL-R---
A0A6M6AEV2_E1B19K-01      --------------------------EE----------------------
A0A6M6AES6_E1B19K-01      --------------------------EE----------------------
A0A9X9P8C6_E1B19K-01      --------------------------EE----------------------
A0A6B9DS29_E1B19K-01      --------------------------EE----------------------
W0S1G8_E1B19K-01          --------------------------EEE---------------------
J9Z4H6_E1B19K-01          --------------------------EQQQQQ-----QQQQE-EA-R---
I6LES1_E1B19K-03          --------------------------VDVT-----------E-DL-R---
A0A2H5AI04_E1B19K-01      --------------------------EEDE--------------------
A0A2H5AI72_E1B19K-01      --------------------------EEDE--------------------
A0A2H5AIL3_E1B19K-01      --------------------------EEDE--------------------
A0A0M5L3Y4_E1B19K-01      --------------------------EENE--------------------
Q5C8R2_E1B19K-01          --------------------------EENE--------------------
A0A2H5AII9_E1B19K-01      --------------------------EENE--------------------
A0A2H5AIN5_E1B19K-01      --------------------------EENE--------------------
A0A2H5AIU0_E1B19K-01      --------------------------EENE--------------------
A0A2H5AIL0_E1B19K-01      --------------------------EENE--------------------
A0A2H5AIS9_E1B19K-01      --------------------------EENE--------------------
A0A2H5AIT6_E1B19K-01      --------------------------EENE--------------------
M9YXY5_E1B19K-01          --------------------------EE----------------------
H9AAS0_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
H9AAV3_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
H9AAY5_E1B19K-01          --------------------------EEQSPE------VKPE-VA-G---
                                                                            

Q7T8D8_E1B19K-03          --------------------------V--VELRVQTESAVGT--------
Q6RK98_E1B19K-03          --------------------------V--AQLREQTESAVAT--------
P04492_E1B19K-02          -----S--------------------D--HLTLSCLRTDYES--------
Q2KSM8_E1B19K-01          -----RQ--Q---------------QQ--EDQEENPRAGLDP--------
M9YVF6_E1B19K-01          ------------------------------EEEENPRAGVDP--------
T2CI10_E1B19K-01          PTMPAV---L---------------EE--EHQEDNPRVGLDP--------
A0A1W5PVU4_E1B19K-01      -----DQ--T---------------RL--LEAEEEPRAGMDP--------
A0A3Q9HK00_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A9X9PKC1_E1B19K-01      --------------------------E--EEEEENLRAGLDP--------
A0A5K6WAR5_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
T2CI10_E1B19K-02          -----P--------------------D--HLVIACTGAEFGS--------
A0A2H5AIC5_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A0M4N3Z1_E1B19K-01      -----QE--E---------------QQ--VQEEGEMRSGLDP--------
A0A3S9SPV1_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A9W3HRK4_E1B19K-02      -----L--------------------D--HCQHSCLREEFSS--------
A0A7L4WJT1_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
D3JIR7_E1B19K-02          -----S--------------------D--HLTLSCLRTDYES--------
Q2KSM8_E1B19K-03          -----P--------------------D--HLVLSCTGTEFGS--------
A0A7U3RVU4_E1B19K-01      --------------------------E--EEEEENLRAGLDP--------
F2WTM9_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
A0A0M4NHE0_E1B19K-01      -----PE--A---------------QG--EAKEEALRSGLDP--------
A0A2H4PJ75_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
G0ZAH2_E1B19K-01          -----RE--REQQQQEGEMTTSIWRPS--MEAEWPPRAGMDP--------
P10406_E1B19K-01          -----------------------------------------P--------
M0QU02_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
J9Z4H6_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
P04492_E1B19K-01          -----------------------------KEEERNP-----A--------
A0A898KBW7_E1B19K-01      --------------------------E--EEEEENLRAGLDP--------
A0A7L4WG90_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3S9SND6_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
J7I6T8_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
A0A5H2QAX5_E1B19K-01      ---------------------------------------QNT--------
Q6QPB7_E1B19K-01          PQQEQQQ--E---------------EE--EDREENPRAGLDP--------
A0A8G1GLF6_E1B19K-01      ------------------------------EEEENLRAGLDP--------
T1UG63_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
A0A3Q9HJ63_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
T1UEX7_E1B19K-02          -----S--------------------D--HLTLSCLRTDYES--------
F6KST6_E1B19K-01          -----QE--E---------LETILEEEAMNMEEQNPRAGLDP--------
A0A482EVC6_E1B19K-02      -----T--------------------D--HQMLSCLRTDYES--------
A0A3Q9HK78_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
H9AAA8_E1B19K-01          -----QGEEQ---------------EQ--E-QKPALRSGLDP--------
A0MK43_E1B19K-02          -----T--------------------D--HHMLSCLRTDYES--------
Q32UI6_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
A0A3S6PYX7_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
Q5GFC7_E1B19K-03          -----P--------------------D--HLVLSCTGTEFGS--------
A0A3Q9HJ54_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A898KBR0_E1B19K-01      -----------------------------EEEEENLRAGLDP--------
J9Z4N4_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
P10544_E1B19K-01          -----------------------------EEEEENLRAGLDP--------
F4ZCJ8_E1B19K-01          --------------------------E--EEEEENLRAGLDP--------
Q8UY91_E1B19K-01          -----QQ--Q---------------QE--EDQEENPRAGLDP--------
A0A9W3I4N3_E1B19K-01      -----RE--D---------LEAISEEE--SGMEENPRAGLDP--------
A0A1L3INW0_E1B19K-01      -----WG--A---------------LE--NLAEEDPRAGLDP--------
A0A097IW62_E1B19K-01      -----DR--V---------------CL--L-EAENPRAGMDP--------
A0A3G4W995_E1B19K-01      ------------------------------EEEENLRAGLDP--------
A0A7D0TLU2_E1B19K-01      -----LR--R---------------GE--EQSLLYLQSGLDPRKCHLVHI
G9G841_E1B19K-01          --Q-QQR--Q---------------QE--EDQEENPRAGLDP--------
Q6VGV8_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
P06501_E1B19K-01          -----QE--E---------------EQ--V--QEEMRSGLDP--------
Q71BY5_E1B19K-01          --NEPG--------------------Q--PLDLSCKR-------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          -----P--------------------D--HLVLACTRAEFGS--------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          -----P--------------------D--HLVLSCTGTEFGS--------
Q5GFC7_E1B19K-04          -----P--------------------D--HLVLSCTGTEFGS--------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      -----QG--E---------------EQ--E-QKPALRSGLGP--------
W6EIX6_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
W6EIX6_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
Q7T8D8_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q7T8D8_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
Q8B8U7_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q32UI6_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
B9A5Q1_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B9A5T7_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QU76_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QU76_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0A0B4SJH1_E1B19K-01      PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A0B4SJH1_E1B19K-02      -----P--------------------D--HLVLACTGAEFGS--------
Q2KS85_E1B19K-01          PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q2KS85_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
C5HDR2_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
C5HDR2_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
D3GBW3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QUB4_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
W8CZB0_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
W8CZB0_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QUF3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QUF3_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QUJ3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QUJ3_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QUN2_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
C4P207_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
R4HLJ6_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
R4HLJ6_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
M0QTS5_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QTS5_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QUS9_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
M0QUS9_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
Q3ZL02_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q3ZL02_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
M0QV47_E1B19K-01          TSM-LEE--E---------------MR--ETMDENPRSGLDP--------
M0QV47_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QV87_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
M0QV87_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QVC7_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QVC7_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QVG6_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
M0QVG6_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QVK6_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
M0QVP5_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
M0QVP5_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
Q4KSL0_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QUW8_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
M0QUW8_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0A3G9JTX5_E1B19K-01      -----------------------------------------P--------
A0A3G9K5X3_E1B19K-01      -----RQ--Q---------------QQ--EDQEENPRAGLDP--------
A0A3G9CMQ4_E1B19K-01      -------------------------QQ--EDQEENPRAGLDP--------
Q3ZKW2_E1B19K-01          PTMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q3ZKW2_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
M0QVT4_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0MK43_E1B19K-01          -----------------------------PEETENLRAGLDP--------
A0A3Q9FFS0_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A3Q9FFS0_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
E5RWD9_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B9A5L5_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
A0A7G5F9T0_E1B19K-01      PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A7G5FB98_E1B19K-01      PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A7G5FB98_E1B19K-02      -----P--------------------D--HLVIARTGAEFGS--------
C7SRS7_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A1Y1BXT7_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E9P585_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E9P585_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
G1FC01_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
G1DE13_E1B19K-01          ---------------------------------------QNT--------
G1FBW4_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
G1FBW4_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
R4HLA0_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
H5T740_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
K7NG43_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
T1UHL7_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UHL7_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
R4HMC6_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
R4HMC6_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
W8VNG2_E1B19K-01          TSM-LEE--E---------------MR--EAMDDNPRSGLDP--------
A0A3G8WH01_E1B19K-01      -----------------------------KEEERNP-----A--------
D3JIR7_E1B19K-01          -----------------------------ELEQRDP-----A--------
A0A5H2QAX5_E1B19K-02      -----S--------------------D--HLTLSCLRTDYDS--------
D0Z5R9_E1B19K-01          ---------------------------------------QNT--------
Q2KRU2_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
R4HLE1_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
R4HLE1_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
Q7T951_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A8B0L9Y2_E1B19K-01      P--PAV---L---------------QE--EQQEDNPRAGLDP--------
A0A8B0LBX6_E1B19K-01      PTMPVV---L---------------QE--EQQEDNPRAGLDP--------
A0A8B0LCV0_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
A0A8B0LD36_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q2Y0J3_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q2Y0J3_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
A0A220VZ73_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q5EY83_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q5EY83_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
Q5EY83_E1B19K-03          -----P--------------------D--HLVLACTGAEFGS--------
Q6RK98_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
A0A7D6TSN5_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
Q71BY5_E1B19K-02          --NEPG--------------------Q--PLDLSCKR-------------
Q71BY5_E1B19K-04          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A1U9ALK7_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A4P2SGW2_E1B19K-02      -----P--------------------D--HLVLACTRAEFGS--------
P03246_E1B19K-01          -----R---R---------------RQ--EQSPWNPRAGLDP--------
Q6WQ37_E1B19K-01          -----R---R---------------RQ--EQSPWNPRAGLDP--------
E1U5L6_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
E1U5L6_E1B19K-03          -----P--------------------D--HLVLACTRAEFGS--------
F1DT57_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
F1DT57_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0A1P7YWR9_E1B19K-01      TSM-LEE--E---------------MR--EAMDKNPRSGLDP--------
A0A1P7YWR9_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A1P7YWY2_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A1P7YWY2_E1B19K-01      TSM-LEE--E---------------MR--ESMDKNPRSGLDP--------
A0A1P7YXN8_E1B19K-01      TSM-LEE--E---------------MR--EAMDKNPRSGLDP--------
A0A1P7YYY5_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A1P7YYY5_E1B19K-01      TSM-LEE--E---------------IR--EAMDKNPRSGLDP--------
A0A1P8C849_E1B19K-01      TSM-LEE--E---------------MR--EAMDKNPRSGLDP--------
B9A5A7_E1B19K-01          TSM-LEE--E---------------MR--EAMDKNPRSGLDP--------
M0QU02_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
A0A3G8W6L2_E1B19K-01      -----RQ--R---------------QQ--EDQEENPRAGLDP--------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          -----P--------------------D--HLVLSCTGTEFGS--------
Q2KSG6_E1B19K-03          -----P--------------------D--HLVLSCTGTEFGS--------
Q5GFC7_E1B19K-02          -----------------------------------------P--------
A0A142G3J2_E1B19K-01      -----------------------------EEEEENLRAGLDP--------
P10543_E1B19K-01          -----------------------------EEEEENLRAGLDP--------
A0A1S6ELT2_E1B19K-01      --------------------------E--EEERENLRAGLDP--------
A0A3G8W407_E1B19K-01      -------------------------------EEENLRAGLDP--------
A0A482EVC6_E1B19K-01      --------------------------E--EEEEENLRAGLDP--------
A0A7U3RWV6_E1B19K-01      --------------------------E--EEGEEN---------------
A0A898KBS1_E1B19K-01      --------------------------E--EEEEENLRAGLDP--------
A0A513TZR1_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A516UYM9_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A0K0PX35_E1B19K-01      PAMPSV---L---------------EE--EQQEDNPRAGLDP--------
A0A0K0PX99_E1B19K-01      PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A6M6AA96_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
I6LEP5_E1B19K-03          -----P--------------------D--HLVLACTGAEFGS--------
I6LEP5_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
J7ID56_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
T1UE63_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
T1UF50_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
T1UIP3_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
T1UJX4_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
T1UJX4_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
A0A291P1B2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3Q9HJZ5_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3Q9HLF7_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3S9SNH4_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3S9SNY0_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3S9SP19_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3S9SSS2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A6M4W5T4_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A7D0TN91_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A7L4WGT1_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A7L4WIC2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A7L4WIG2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A7L4WK62_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A8F9W8V2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
E1ARN8_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
J7I6T8_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
J9Z4N4_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
T1UG63_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A075TSZ1_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A097I4T0_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A097I4T0_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A0G2UY10_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A0G2UY10_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A1J0MS84_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A291B0H2_E1B19K-01      TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
A0A384ZUF2_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A384ZUM9_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A384ZUM9_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
F8UFP5_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
F8UFP5_E1B19K-01          TSM-LEE--E---------------MR--EAMDDNPRSGLDP--------
G3CK71_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
G3CK71_E1B19K-01          TSM-LEE--E---------------MR--QAMYENPRSGLDP--------
T1UG22_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UGT5_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UGT5_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
T1UGU0_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UGX3_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UGX3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UGY3_E1B19K-02          -----A--------------------D--HLVMACTGTEFSS--------
T1UHG3_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UHG3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UHH6_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UHH6_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UHQ8_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UHQ8_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UHZ2_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UK99_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
T1UK99_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UKP8_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UKQ0_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UKQ0_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
T1UKV6_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
T1UKV6_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1ULJ8_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1ULJ8_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1ULP4_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
X4Y9D2_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A0A1EUB2_E1B19K-01      -----------------------------PGEMENLRAGLDP--------
A0A0A1EUC8_E1B19K-01      -----------------------------PGETENLRAGLDP--------
A0A0A1EUE4_E1B19K-01      -----------------------------PDETENLRAGLDP--------
A0A2H5AI21_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AI40_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AI99_E1B19K-01      -----------------------------PVETDNPRAGLDP--------
A0A2H5AID8_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A0M3TH18_E1B19K-01      -----DQ--T---------------RL--LEAEEEPRAGTDP--------
A0A2H4CJZ0_E1B19K-01      --------------------------E--PEEEENPRAGLDP--------
H8PFZ1_E1B19K-01          --------------------------E--LEEEENPRAGLDP--------
A0A0M3TH31_E1B19K-01      -----------------------------EEENENPRAGVDP--------
Q6QPF3_E1B19K-01          PQQEQQQ--E-------------------EDREENPRAGLDP--------
A0A9W3HRK4_E1B19K-01      -----RE--D---------LEAISEEES-GMEEKNPRAGLDP--------
F2WTJ7_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
A0A9W3INM3_E1B19K-01      -----RE--D---------LEAISEEES-GMEEKNPRAGLDP--------
H9AA76_E1B19K-01          -----QG--E---------------EQ--E-PEPALRSGLDP--------
H9AAD9_E1B19K-01          -----PE--A---------------QG--EAKEETLRSGLDP--------
H9AAH3_E1B19K-01          -----PE--A---------------QG--EAKEETLRSGLNP--------
H9AAK5_E1B19K-01          -----PE--A---------------QG--EAKEETLRSGLDP--------
H9AAN8_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
M9YVA3_E1B19K-01          -----QGEEQ---------------EQ-----EPALRSGLDP--------
Q6QPI9_E1B19K-01          PQQEQQQ--E-------------------EDREENLRAGLDP--------
Q8B6X5_E1B19K-01          -----QE--E---------------QQ--VQEEGEMRSGLDP--------
B5SNR1_E1B19K-01          --------------------------E--EEEEENLRAGLDP--------
A0A1L7NRH1_E1B19K-01      PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q5UW22_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
J7H4R9_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
D2DM83_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A7U3S224_E1B19K-01      PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
J7I6W7_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
J7I6W7_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
M0QUB4_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
C4P207_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
D4N3H6_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QVK6_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QVT4_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A3G8WIY5_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1ULP4_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A7R6T9I9_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B6C6W8_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B9A681_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A1Y1BYF1_E1B19K-01      TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
T1UHZ2_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QU41_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0A075IQ70_E1B19K-01      PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A075IQ70_E1B19K-02      -----P--------------------D--HLVLACTGAEFGS--------
K7NG43_E1B19K-01          PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q2KRU2_E1B19K-01          PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
T1UIP3_E1B19K-01          PAMPAV---L---------------EE--EQQEDNPRAGLDP--------
A0A3S6PYX7_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
G1FC01_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E5RWL1_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QU41_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B2VQE3_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
B6DU90_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QUN2_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E1CIM6_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E1AI10_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
H0PPE7_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
Q9YL99_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
K7ZLN6_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E1CIR1_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
E1AI10_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
A0A384ZUF2_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
R4HLA0_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q2KSL3_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
A0A5J6CTQ0_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
I6LES1_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
Q2KSL3_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
I6LEP5_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
I6LES1_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
T1UF50_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
M0QV08_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
G9JUV5_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
M0QV08_E1B19K-02          -----P--------------------D--HLVMACTGTEFSS--------
T1UFS4_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
T1UFS4_E1B19K-02          -----P--------------------D--HLVIARTGAEFGS--------
X4YVU5_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
E1CIJ0_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
T1UGU0_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
Q2KSM8_E1B19K-02          -----------------------------------------P--------
A0A2R3WNP3_E1B19K-01      -----------------------------------------P--------
Q2KSG6_E1B19K-01          -----RQ--Q---------------QQ--EDQEENPRAGLDP--------
Q5GFC7_E1B19K-01          -------------------------QQ--EDQEENPRAGLDP--------
Q5GFC8_E1B19K-01          -------------------------QQ--EDQEENPRAGLDP--------
Q6H1D7_E1B19K-01          -------------------------QQ--EDQEENPRAGLDP--------
T1UGY3_E1B19K-01          TSM-LEE--E---------------MR--EAMDENPRSGLDP--------
A0A7U3S1T6_E1B19K-01      PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
J7ID56_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
T1UKP8_E1B19K-01          TSM-LEE--E---------------MR--QAMDENPRSGLDP--------
A0A075TSZ1_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A897JQR0_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
I1V161_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
A0A5P8KYF0_E1B19K-01      PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
J7I6S4_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
A0A897JQR0_E1B19K-02      -----P--------------------D--HLVLACTGAEFGS--------
I1V161_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
A0A5P8KYF0_E1B19K-02      -----P--------------------D--HLVLACTGAEFGS--------
J7I6S4_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
T1UEX7_E1B19K-01          ---------------------------------------QNT--------
T1UE63_E1B19K-01          PVMPAV---L---------------EE--EQQEDNPRAGLDP--------
Q6RK98_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
J7I6Q4_E1B19K-01          PTMPAV---L---------------QE--EQQEDNPRAGLDP--------
J7I6Q4_E1B19K-02          -----P--------------------D--HLVLACTGAEFGS--------
A0A4P2SGW2_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
E1ARN8_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A6M5E4Y6_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
P03247_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A3G8W3H5_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
E1U5L6_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
A0A516UYI9_E1B19K-01      -----RR--R---------------RQ--EQSPWNPRAGLDP--------
J9Z5H0_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
Q6VGV8_E1B19K-01          -----R---R---------------RQ--EQSPWNPRAGLDP--------
A0A0G2R248_E1B19K-01      -----R---R---------------RQ--EQSPWNPRAGLDP--------
A0A0G2R248_E1B19K-02      -----P--------------------D--HLVLACTRAEFGS--------
J9Z5H0_E1B19K-02          -----P--------------------D--HLVLACTRAEFGS--------
A0A1P7YXN8_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
A0A1P8C849_E1B19K-02      -----P--------------------D--HLVMACTGTEFSS--------
T1UG22_E1B19K-01          TSM-LEE--E---------------MR--EAMDKNPRSGLDP--------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      -----RQ--Q---------------QQ--EDQEENPRAGLDP--------
A0A2R3WN62_E1B19K-01      -----------------------------------------P--------
Q6H1D7_E1B19K-02          -----P--------------------D--HLVLSCTGTEFGS--------
A0A6M6AEV2_E1B19K-01      -----------------------------EEEEENLRAGLDP--------
A0A6M6AES6_E1B19K-01      -------------------------------EEENLRAGLDP--------
A0A9X9P8C6_E1B19K-01      -------------------------------EEENLRAGLDP--------
A0A6B9DS29_E1B19K-01      -----------------------------EEEEENLRAGLDP--------
W0S1G8_E1B19K-01          -----------------------------EEEEENLRAGLDP--------
J9Z4H6_E1B19K-01          -----RR--R---------------RQ--EQSPWNPRAGLDP--------
I6LES1_E1B19K-03          -----P--------------------D--HLVLACTGAEFGS--------
A0A2H5AI04_E1B19K-01      -----------------------------PGETENLRAGLDP--------
A0A2H5AI72_E1B19K-01      -----------------------------PGETENLRAGLDP--------
A0A2H5AIL3_E1B19K-01      -----------------------------PGETENLRAGLDP--------
A0A0M5L3Y4_E1B19K-01      -----------------------------PEETENLRAGLDP--------
Q5C8R2_E1B19K-01          -----------------------------PEETENLRAGLDP--------
A0A2H5AII9_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AIN5_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AIU0_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AIL0_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AIS9_E1B19K-01      -----------------------------PEETENLRAGLDP--------
A0A2H5AIT6_E1B19K-01      -----------------------------PEETENLRAGLDP--------
M9YXY5_E1B19K-01          -----------------------------EEENENPRAGVDP--------
H9AAS0_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
H9AAV3_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
H9AAY5_E1B19K-01          -----QG--E---------------EQ--E-QEPALRSGLDP--------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      PQWPPELRRILTINEDGQGLKGVKRERGASEATEEVRNLTFSFKISPLAE
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      PVSGQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVAL
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      RPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLG
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
A0A9X9PKC1_E1B19K-01      --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
A0A9W3HRK4_E1B19K-02      --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
A0A8G1GLF6_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
A0A9W3I4N3_E1B19K-01      --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      MDGVVIMNVRFTGPNFSGTVFLANTNLILHGPGFHRFVNTCIEAWTDVRV
G9G841_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
P03246_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
A0A9W3HRK4_E1B19K-01      --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
A0A9W3INM3_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A9X9P8C6_E1B19K-01      -------------