Dataset for protein E1B 19K of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

413 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
P03248_E1B19K-03        -------------------------------------------------M
D3JIR7_E1B19K-02        -------------------------------------------------M
A0A5H2QAX5_E1B19K-      -------------------------------------------------M
T1UEX7_E1B19K-02        -------------------------------------------------M
M0QU02_E1B19K-02        -------------------------------------------------M
Q695T5_E1B19K-02        -------------------------------------------------M
P04492_E1B19K-02        -------------------------------------------------M
A0MK43_E1B19K-02        ------------------------------------------------ME
A0A482EVC6_E1B19K-      -------------------------------------------------M
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
Q6VGV8_E1B19K-02        -------------------------------------------------M
A0A0G2R248_E1B19K-      -------------------------------------------------M
A0A4P2SGW2_E1B19K-      -------------------------------------------------M
E1ARN8_E1B19K-02        -------------------------------------------------M
E1U5L6_E1B19K-02        -------------------------------------------------M
J9Z5H0_E1B19K-02        -------------------------------------------------M
J9Z4N4_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
J7I6T8_E1B19K-02        -------------------------------------------------M
J9Z4H6_E1B19K-02        -------------------------------------------------M
T1UGY3_E1B19K-02        -------------------------------------------------M
A0A1P7YWR9_E1B19K-      -------------------------------------------------M
A0A1P7YWY2_E1B19K-      -------------------------------------------------M
A0A1P7YXN8_E1B19K-      -------------------------------------------------M
A0A1P8C849_E1B19K-      -------------------------------------------------M
T1UG22_E1B19K-02        -------------------------------------------------M
A0A1P7YYY5_E1B19K-      -------------------------------------------------M
M0QUW8_E1B19K-02        -------------------------------------------------M
M0QVP5_E1B19K-02        -------------------------------------------------M
M0QUS9_E1B19K-02        -------------------------------------------------M
T1UKQ0_E1B19K-02        -------------------------------------------------M
M0QV47_E1B19K-02        -------------------------------------------------M
T1UGU0_E1B19K-02        -------------------------------------------------M
G1FBW4_E1B19K-02        -------------------------------------------------M
F1DT57_E1B19K-02        -------------------------------------------------M
E9P585_E1B19K-02        -------------------------------------------------M
T1UKP8_E1B19K-02        -------------------------------------------------M
W8CZB0_E1B19K-02        -------------------------------------------------M
T1ULJ8_E1B19K-02        -------------------------------------------------M
M0QUB4_E1B19K-02        -------------------------------------------------M
M0QVT4_E1B19K-02        -------------------------------------------------M
M0QVG6_E1B19K-02        -------------------------------------------------M
T1UK99_E1B19K-02        -------------------------------------------------M
C5HDR2_E1B19K-02        -------------------------------------------------M
A0A3S6PYX7_E1B19K-      -------------------------------------------------M
A0A097I4T0_E1B19K-      -------------------------------------------------M
M0QV87_E1B19K-02        -------------------------------------------------M
T1UKV6_E1B19K-02        -------------------------------------------------M
F8UFP5_E1B19K-02        -------------------------------------------------M
T1UGT5_E1B19K-02        -------------------------------------------------M
A0A384ZUM9_E1B19K-      -------------------------------------------------M
M0QUJ3_E1B19K-02        -------------------------------------------------M
T1UHQ8_E1B19K-02        -------------------------------------------------M
T1UHH6_E1B19K-02        -------------------------------------------------M
T1UHL7_E1B19K-02        -------------------------------------------------M
A0A075TSZ1_E1B19K-      -------------------------------------------------M
M0QVK6_E1B19K-02        -------------------------------------------------M
T1ULP4_E1B19K-02        -------------------------------------------------M
C4P207_E1B19K-02        -------------------------------------------------M
M0QUN2_E1B19K-02        -------------------------------------------------M
E1AI10_E1B19K-02        -------------------------------------------------M
A0A384ZUF2_E1B19K-      -------------------------------------------------M
T1UHG3_E1B19K-02        -------------------------------------------------M
M0QTS5_E1B19K-02        -------------------------------------------------M
M0QV08_E1B19K-02        -------------------------------------------------M
M0QU76_E1B19K-02        -------------------------------------------------M
M0QU41_E1B19K-02        -------------------------------------------------M
M0QVC7_E1B19K-02        -------------------------------------------------M
A0A3Q9FFS0_E1B19K-      -------------------------------------------------M
T1UGX3_E1B19K-02        -------------------------------------------------M
T1UHZ2_E1B19K-02        -------------------------------------------------M
A0A0G2UY10_E1B19K-      -------------------------------------------------M
M0QUF3_E1B19K-02        -------------------------------------------------M
G1FC01_E1B19K-02        -------------------------------------------------M
G3CK71_E1B19K-02        -------------------------------------------------M
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        -------------------------------------------------M
Q5GFC7_E1B19K-03        -------------------------------------------------M
Q6H1D7_E1B19K-02        -------------------------------------------------M
R4HLE1_E1B19K-02        -------------------------------------------------M
R4HLA0_E1B19K-02        -------------------------------------------------M
J7ID56_E1B19K-02        -------------------------------------------------M
Q5EY83_E1B19K-02        -------------------------------------------------M
K7NG43_E1B19K-02        -------------------------------------------------M
A0A0B4SJH1_E1B19K-      -------------------------------------------------M
A0A075IQ70_E1B19K-      -------------------------------------------------M
T1UIP3_E1B19K-02        -------------------------------------------------M
Q2KRU2_E1B19K-02        -------------------------------------------------M
Q2KS85_E1B19K-02        -------------------------------------------------M
Q3ZKW2_E1B19K-02        -------------------------------------------------M
R4HLJ6_E1B19K-02        -------------------------------------------------M
R4HMC6_E1B19K-02        -------------------------------------------------M
A0A897JQR0_E1B19K-      -------------------------------------------------M
Q2KSL3_E1B19K-02        -------------------------------------------------M
Q2Y0J3_E1B19K-02        -------------------------------------------------M
I1V161_E1B19K-02        -------------------------------------------------M
Q6RK98_E1B19K-02        -------------------------------------------------M
A0A5P8KYF0_E1B19K-      -------------------------------------------------M
I6LEP5_E1B19K-02        -------------------------------------------------M
I6LES1_E1B19K-02        -------------------------------------------------M
J7I6Q4_E1B19K-02        -------------------------------------------------M
J7I6S4_E1B19K-02        -------------------------------------------------M
T1UF50_E1B19K-02        -------------------------------------------------M
T1UJX4_E1B19K-02        -------------------------------------------------M
A0A7G5FB98_E1B19K-      -------------------------------------------------M
Q32UI6_E1B19K-02        -------------------------------------------------M
J7I6W7_E1B19K-02        -------------------------------------------------M
Q7T8D8_E1B19K-02        -------------------------------------------------M
Q3ZL02_E1B19K-02        -------------------------------------------------M
T1UFS4_E1B19K-02        -------------------------------------------------M
W6EIX6_E1B19K-02        -------------------------------------------------M
T1UE63_E1B19K-02        -------------------------------------------------M
Q2KSG6_E1B19K-03        -------------------------------------------------M
Q2KSM8_E1B19K-03        -------------------------------------------------M
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------MRHIICHGGVITEEMAA-------------------------
Q71BY5_E1B19K-02        --------MRHIICHGGVITEEMAA-------------------------
P03248_E1B19K-03        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
D3JIR7_E1B19K-02        EPDVPAELGLHAGLHGNAAVEGMAH-------------------------
A0A5H2QAX5_E1B19K-      EREVPPELGLHAGLHDNAFVEGMAE-------------------------
T1UEX7_E1B19K-02        EREVPPELGLHAGLHGNAFVEGMAE-------------------------
M0QU02_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
Q695T5_E1B19K-02        ERADAAQPGLYSGLPDAMPMEVRNQ-------------------------
P04492_E1B19K-02        EREIPPELGLHAGLHVNAAVEGM---------------------------
A0MK43_E1B19K-02        QQRQPPVVGVHAGLHGDGSVEGH---------------------------
A0A482EVC6_E1B19K-      ERPNPSVGGVYSGLHDNGPVENP---------------------------
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
Q6VGV8_E1B19K-02        ERRNPSERGVPAGFSGHASVESGCE-------------------------
A0A0G2R248_E1B19K-      ERRNPSERGVPAGFSGHASVESGCE-------------------------
A0A4P2SGW2_E1B19K-      ERRNPSERGVPAGFSGHASVESGGE-------------------------
E1ARN8_E1B19K-02        ERRNPSERGVPAGFSGHAFVESGGE-------------------------
E1U5L6_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z5H0_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z4N4_E1B19K-02        ERRNPSERGVPAGFSGHAFVESSGE-------------------------
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z4H6_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
T1UGY3_E1B19K-02        EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YWR9_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YWY2_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YXN8_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P8C849_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
T1UG22_E1B19K-02        EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YYY5_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
M0QUW8_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
M0QVP5_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
M0QUS9_E1B19K-02        EPGHPTEQGLHPGLHGHAPVEGLGQ-------------------------
T1UKQ0_E1B19K-02        EPANPLNQGLHPGLHGHAPVEGLGQ-------------------------
M0QV47_E1B19K-02        EPANPPNQGLHPGLHGHASVEGLGQ-------------------------
T1UGU0_E1B19K-02        EPANPPNQGLHPGLHGHASVEGLGQ-------------------------
G1FBW4_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
F1DT57_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
E9P585_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UKP8_E1B19K-02        EPGHPTEQGIHPGLRSHAPVEVLDQ-------------------------
W8CZB0_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGLGQ-------------------------
T1ULJ8_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUB4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QVT4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QVG6_E1B19K-02        EPANPSDQGLHPGLHGHASVEGLGQ-------------------------
T1UK99_E1B19K-02        EPANPLNQGLHPGLHGHAPVEGLGQ-------------------------
C5HDR2_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
A0A3S6PYX7_E1B19K-      EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
A0A097I4T0_E1B19K-      EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
M0QV87_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UKV6_E1B19K-02        EPGHPTEQGLHPGLRSHASVEGLDQ-------------------------
F8UFP5_E1B19K-02        EPEHPTEQGLHPGLRGHAPVEGLDQ-------------------------
T1UGT5_E1B19K-02        EPEHPTEQGLHPGLRGHAPVEGLGQ-------------------------
A0A384ZUM9_E1B19K-      EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUJ3_E1B19K-02        EPGHPTEQGIHPGLRSHAPVEGLDQ-------------------------
T1UHQ8_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UHH6_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
T1UHL7_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
A0A075TSZ1_E1B19K-      EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
M0QVK6_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1ULP4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
C4P207_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUN2_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
E1AI10_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
A0A384ZUF2_E1B19K-      EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UHG3_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QTS5_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
M0QV08_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
M0QU76_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
M0QU41_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
M0QVC7_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
A0A3Q9FFS0_E1B19K-      EPEHPTEQGLHSGLCSHAPVEGMGE-------------------------
T1UGX3_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGLGQ-------------------------
T1UHZ2_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
A0A0G2UY10_E1B19K-      EPEHPTEQGLHSGLRGHAPVEVLDQ-------------------------
M0QUF3_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
G1FC01_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
G3CK71_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        DPTDPLQQGIRFGFHSSSFVENMEG-------------------------
Q5GFC7_E1B19K-03        ESRNPFQQGLPAGFLSSSFVENMEV-------------------------
Q6H1D7_E1B19K-02        ESRNPFQQGLPAGFLSSSFVENMEV-------------------------
R4HLE1_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
R4HLA0_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7ID56_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q5EY83_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
K7NG43_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
A0A0B4SJH1_E1B19K-      DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
A0A075IQ70_E1B19K-      DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
T1UIP3_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q2KRU2_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q2KS85_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q3ZKW2_E1B19K-02        DPTNPLQQGIRFGFHSSSFVENMEG-------------------------
R4HLJ6_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
R4HMC6_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
A0A897JQR0_E1B19K-      DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q2KSL3_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q2Y0J3_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I1V161_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q6RK98_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
A0A5P8KYF0_E1B19K-      DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I6LEP5_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I6LES1_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7I6Q4_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7I6S4_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
T1UF50_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
T1UJX4_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
A0A7G5FB98_E1B19K-      DPADSFQQGIRFGFRSHSIVENMEG-------------------------
Q32UI6_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
J7I6W7_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
Q7T8D8_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
Q3ZL02_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
T1UFS4_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
W6EIX6_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
T1UE63_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
Q2KSG6_E1B19K-03        ESRNPFQQGLPVGFLSSSFVESMEV-------------------------
Q2KSM8_E1B19K-03        ESRNPFQQGLPVGFLSSSFVESMEV-------------------------
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --SLLDQLIEEVLADNLPPPSHFEPPTLH---ELYDLDVTAPED------
Q71BY5_E1B19K-02        --SLLDQLIEEVLADNLPPPSHFEPPTLH---ELYDLDVTAPED------
P03248_E1B19K-03        --SQDEDNLRLLASAASRSSRDTETPTYH----ASGSAGGAAGG----Q-
D3JIR7_E1B19K-02        -----EEGLHLLAGAAFDHAATANVAGGG------AGAAGPCGGEVNME-
A0A5H2QAX5_E1B19K-      -----EEGLHLLAGAASNHAAVA------------GGAAEHYDGGVNME-
T1UEX7_E1B19K-02        -----EEGLHLLAGAASNHAAVA------------GGAAEHYDGGVNME-
M0QU02_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----E-
Q695T5_E1B19K-02        ---EGEEAVRALGGEASVSAPAASASSSAAEAGGSGSHFGGGERHGREE-
P04492_E1B19K-02        --AE-EEGLHLLAGAAFDHAAAADVARGE-----GGGAEPCGGG----E-
A0MK43_E1B19K-02        --AA-EEGLHLLAG-----AASA--AGPS-----GGGERAGGDR----E-
A0A482EVC6_E1B19K-      --AAEEEGLRLLAG-----AASARSGSSA-----GGGGGGGGGG----E-
A0A7D0TLU2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVAFLSFIK----DKWSEETHLSGGYLLDF
Q6VGV8_E1B19K-02        --TQESPATVVFRPPGDNTDGGAAAAA--------GGSQAAAAGAEPME-
A0A0G2R248_E1B19K-      --TQESPATVVFRPPGDNTDGGAAAAA--------GGSQAAAAGAEPME-
A0A4P2SGW2_E1B19K-      --TQESPATVVFRPPGNNTDGGAAAAAAA----AGGSQAAAAAGAEPME-
E1ARN8_E1B19K-02        --TQESPTTVVFRPPGNNTDGGAAAATAA----AGGSQAAAAAGAEPME-
E1U5L6_E1B19K-02        --TQESPATVVFRPPGNNTDG------GA---TAGGSQAAAAAGAEPME-
J9Z5H0_E1B19K-02        --TQESPATVVFRPPGNNTDG------GA---TAGGSQAAAAAGAEPME-
J9Z4N4_E1B19K-02        --TQESPATVVFRPPGNNTDG----GAAA---AAGGSQAAAAAGAEPME-
T1UG63_E1B19K-02        --TQESPATVVFRPPGNNTDGGAAAAAAA---AGGSQAAAAAAGAEPME-
J7I6T8_E1B19K-02        --TQESPATVVFRPPGNNTDG--GAAAAA---AAGGSQAAAAAGAEPME-
J9Z4H6_E1B19K-02        --TQESPATVVFRPPGNNTDGRAAAAAAA---AAGGSQAAAAAGAEPME-
T1UGY3_E1B19K-02        --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGGHGR----E-
A0A1P7YWR9_E1B19K-      --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGGHGQ----E-
A0A1P7YWY2_E1B19K-      --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGVHGQ----E-
A0A1P7YXN8_E1B19K-      --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGGHGQ----E-
A0A1P8C849_E1B19K-      --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGGHGQ----E-
T1UG22_E1B19K-02        --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNEGGHGQ----E-
A0A1P7YYY5_E1B19K-      --AAGTENLELLASTASSFGSSSSTQTNI---HVGGRNKGGHGQ----E-
M0QUW8_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
M0QVP5_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
M0QUS9_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
T1UKQ0_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
M0QV47_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGDHGR----E-
T1UGU0_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
G1FBW4_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
F1DT57_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
E9P585_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UKP8_E1B19K-02        --AAGTENLELLASTASSSRSSSSTQTNI---HVGGRNEAGHGR----E-
W8CZB0_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1ULJ8_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QUB4_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QVT4_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QVG6_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----E-
T1UK99_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----E-
C5HDR2_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A3S6PYX7_E1B19K-      --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A097I4T0_E1B19K-      --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QV87_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRDEGGHGR----E-
T1UKV6_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----E-
F8UFP5_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----Q-
T1UGT5_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEGGHGR----E-
A0A384ZUM9_E1B19K-      --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QUJ3_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UHQ8_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UHH6_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UHL7_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A075TSZ1_E1B19K-      --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QVK6_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1ULP4_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
C4P207_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNETGHGR----E-
M0QUN2_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
E1AI10_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A384ZUF2_E1B19K-      --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UHG3_E1B19K-02        --AAGTENLELLASTASSSGSSLSTQTNI---HVGGRNEAGHGR----E-
M0QTS5_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QV08_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QU76_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QU41_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QVC7_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A3Q9FFS0_E1B19K-      --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UGX3_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
T1UHZ2_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
A0A0G2UY10_E1B19K-      --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
M0QUF3_E1B19K-02        --AAGTENLELLAYTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
G1FC01_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHGR----E-
G3CK71_E1B19K-02        --AAGTENLELLASTASSSGSSSSTQTNI---HVGGRNEAGHVR----E-
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        --SQDEDNLRLLASTASGRSRDPETPTDH----ASGFGGGAPRG----Q-
Q5GFC7_E1B19K-03        --PAPECNLRLLAGTAARHSEDPESP-----------AAGGSRR----E-
Q6H1D7_E1B19K-02        --PAPECNLRLLAGTAARHSEDPESP-----------AAGGSRR----E-
R4HLE1_E1B19K-02        --SQDEDNLRLLASAASRSSRDIETPTDH----ASGSAGGAAGG----Q-
R4HLA0_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
J7ID56_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
Q5EY83_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
K7NG43_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
A0A0B4SJH1_E1B19K-      --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
A0A075IQ70_E1B19K-      --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
T1UIP3_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
Q2KRU2_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
Q2KS85_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTGH----ASGSGGGAAGG----Q-
Q3ZKW2_E1B19K-02        --SQHEDNLRLLASAASGSSRDTETPTDH----ASGSGGGAAGG----Q-
R4HLJ6_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
R4HMC6_E1B19K-02        --SQDEDNLKLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
A0A897JQR0_E1B19K-      --SQDEDNLKLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
Q2KSL3_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
Q2Y0J3_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
I1V161_E1B19K-02        --SQDEDNLKLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
Q6RK98_E1B19K-02        --SQDEDNLRLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
A0A5P8KYF0_E1B19K-      --SQDEDNLKLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
I6LEP5_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
I6LES1_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
J7I6Q4_E1B19K-02        --SQDEDNLRLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
J7I6S4_E1B19K-02        --SQDEDNLKLLASAASRSSRDTETPTDH----ASGSAGGAAGG----Q-
T1UF50_E1B19K-02        --SQDEDNLRLLASAASGSSRDTETPTDH----ASGSAGGAAGG----Q-
T1UJX4_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTCH----ASGSGGGTARG----Q-
A0A7G5FB98_E1B19K-      --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
Q32UI6_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
J7I6W7_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
Q7T8D8_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
Q3ZL02_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
T1UFS4_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
W6EIX6_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
T1UE63_E1B19K-02        --SQDEDNLRLLASAAFGCSGNPEASTGH----ASGSGGGTARG----Q-
Q2KSG6_E1B19K-03        --PAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRR----E-
Q2KSM8_E1B19K-03        --PAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRR----E-
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --MINCCELWLFIQRVLPGRYKGSGFQAR---------------------
H9AAK5_E1B19K-01        --MINGCELWLFIQRGLPGRYKGSGFQAR---------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      ----------MFNLHGVLNGAGLKGYIMR---------------------
A0A3Q9HK78_E1B19K-      ----------MFNLHGVLNGAGLKGYIMR---------------------
A0A3S9SPV1_E1B19K-      ----------MFNLHGVLNGAGLKGYIMR---------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      ----------------------------M---------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      -------------MTHGRGLVLYKWQHLG---------------------
X4Y9D2_E1B19K-01        -------------MTHGRGLVLYKWQHLG---------------------
C5HDR2_E1B19K-01        -------------MTHGRGLVLYKWQHLG---------------------
M0QVC7_E1B19K-01        -------------MTHGRGLVLYKWQHLG---------------------
A0A3S6PYX7_E1B19K-      -------------MTHGRGLVLYKWQHLG---------------------
Q4KSL0_E1B19K-01        -------------MTHGRGLVLYKWQHLG---------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      ---------------------------MR---------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
F2WTM9_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
H9AA76_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
A0A1C8EG46_E1B19K-      ---------MINDVNFVCLFKGDYLGGIK---------------------
H9AAN8_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
H9AAS0_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
H9AAV3_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
H9AAY5_E1B19K-01        ---------MINDVNFVCLFKGDYLGGIK---------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------PNEEA-------------
Q71BY5_E1B19K-02        --------------------------------PNEEA-------------
P03248_E1B19K-03        --------------------------------SESRP-------------
D3JIR7_E1B19K-02        --------------------------------QQVQE-------------
A0A5H2QAX5_E1B19K-      --------------------------------PQVQE-------------
T1UEX7_E1B19K-02        --------------------------------PQVQE-------------
M0QU02_E1B19K-02        --------------------------------PEERP-------------
Q695T5_E1B19K-02        --------------------------------SESGA-------------
P04492_E1B19K-02        --------------------------------VNMEQ-------------
A0MK43_E1B19K-02        --------------------------------SESRP-------------
A0A482EVC6_E1B19K-      --------------------------------PEGRS-------------
A0A7D0TLU2_E1B19K-      LAMHLWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWLRRGEEQSLLYL
Q6VGV8_E1B19K-02        --------------------------------PESRP-------------
A0A0G2R248_E1B19K-      --------------------------------PESRP-------------
A0A4P2SGW2_E1B19K-      --------------------------------PESRP-------------
E1ARN8_E1B19K-02        --------------------------------PESRP-------------
E1U5L6_E1B19K-02        --------------------------------PESRP-------------
J9Z5H0_E1B19K-02        --------------------------------PESRP-------------
J9Z4N4_E1B19K-02        --------------------------------PESRP-------------
T1UG63_E1B19K-02        --------------------------------PESRP-------------
J7I6T8_E1B19K-02        --------------------------------PESRP-------------
J9Z4H6_E1B19K-02        --------------------------------PESRP-------------
T1UGY3_E1B19K-02        --------------------------------PEERP-------------
A0A1P7YWR9_E1B19K-      --------------------------------PEERP-------------
A0A1P7YWY2_E1B19K-      --------------------------------PEERP-------------
A0A1P7YXN8_E1B19K-      --------------------------------PEERP-------------
A0A1P8C849_E1B19K-      --------------------------------PEERP-------------
T1UG22_E1B19K-02        --------------------------------PEERP-------------
A0A1P7YYY5_E1B19K-      --------------------------------PEERP-------------
M0QUW8_E1B19K-02        --------------------------------PEERP-------------
M0QVP5_E1B19K-02        --------------------------------PEERS-------------
M0QUS9_E1B19K-02        --------------------------------PEERP-------------
T1UKQ0_E1B19K-02        --------------------------------PEERP-------------
M0QV47_E1B19K-02        --------------------------------PEERP-------------
T1UGU0_E1B19K-02        --------------------------------PEERP-------------
G1FBW4_E1B19K-02        --------------------------------PEERP-------------
F1DT57_E1B19K-02        --------------------------------PEERS-------------
E9P585_E1B19K-02        --------------------------------PEERP-------------
T1UKP8_E1B19K-02        --------------------------------PEERP-------------
W8CZB0_E1B19K-02        --------------------------------PEERP-------------
T1ULJ8_E1B19K-02        --------------------------------PEERP-------------
M0QUB4_E1B19K-02        --------------------------------PEERP-------------
M0QVT4_E1B19K-02        --------------------------------PEERP-------------
M0QVG6_E1B19K-02        --------------------------------PEERP-------------
T1UK99_E1B19K-02        --------------------------------PEERP-------------
C5HDR2_E1B19K-02        --------------------------------PEERP-------------
A0A3S6PYX7_E1B19K-      --------------------------------PEERP-------------
A0A097I4T0_E1B19K-      --------------------------------PEERP-------------
M0QV87_E1B19K-02        --------------------------------PEERP-------------
T1UKV6_E1B19K-02        --------------------------------PEERP-------------
F8UFP5_E1B19K-02        --------------------------------PEERP-------------
T1UGT5_E1B19K-02        --------------------------------PEERP-------------
A0A384ZUM9_E1B19K-      --------------------------------PEERP-------------
M0QUJ3_E1B19K-02        --------------------------------PEERP-------------
T1UHQ8_E1B19K-02        --------------------------------PEERP-------------
T1UHH6_E1B19K-02        --------------------------------PEERP-------------
T1UHL7_E1B19K-02        --------------------------------PEERP-------------
A0A075TSZ1_E1B19K-      --------------------------------PEERP-------------
M0QVK6_E1B19K-02        --------------------------------PEERP-------------
T1ULP4_E1B19K-02        --------------------------------PEERP-------------
C4P207_E1B19K-02        --------------------------------PEERP-------------
M0QUN2_E1B19K-02        --------------------------------PEERP-------------
E1AI10_E1B19K-02        --------------------------------PEERP-------------
A0A384ZUF2_E1B19K-      --------------------------------PEERP-------------
T1UHG3_E1B19K-02        --------------------------------PEERP-------------
M0QTS5_E1B19K-02        --------------------------------PEERP-------------
M0QV08_E1B19K-02        --------------------------------PEERP-------------
M0QU76_E1B19K-02        --------------------------------PEERP-------------
M0QU41_E1B19K-02        --------------------------------PEERP-------------
M0QVC7_E1B19K-02        --------------------------------PEERP-------------
A0A3Q9FFS0_E1B19K-      --------------------------------PEERP-------------
T1UGX3_E1B19K-02        --------------------------------PEERP-------------
T1UHZ2_E1B19K-02        --------------------------------PEERP-------------
A0A0G2UY10_E1B19K-      --------------------------------PEERP-------------
M0QUF3_E1B19K-02        --------------------------------PEERP-------------
G1FC01_E1B19K-02        --------------------------------PEERP-------------
G3CK71_E1B19K-02        --------------------------------PEERP-------------
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        --------------------------------SESRP-------------
Q5GFC7_E1B19K-03        --------------------------------SESRP-------------
Q6H1D7_E1B19K-02        --------------------------------SESRP-------------
R4HLE1_E1B19K-02        --------------------------------SESRP-------------
R4HLA0_E1B19K-02        --------------------------------SESRP-------------
J7ID56_E1B19K-02        --------------------------------SESRP-------------
Q5EY83_E1B19K-02        --------------------------------SESRP-------------
K7NG43_E1B19K-02        --------------------------------SESRP-------------
A0A0B4SJH1_E1B19K-      --------------------------------SESRP-------------
A0A075IQ70_E1B19K-      --------------------------------SESRP-------------
T1UIP3_E1B19K-02        --------------------------------SESRP-------------
Q2KRU2_E1B19K-02        --------------------------------SESRP-------------
Q2KS85_E1B19K-02        --------------------------------SESRP-------------
Q3ZKW2_E1B19K-02        --------------------------------SESRP-------------
R4HLJ6_E1B19K-02        --------------------------------SESRP-------------
R4HMC6_E1B19K-02        --------------------------------SESRP-------------
A0A897JQR0_E1B19K-      --------------------------------SESRP-------------
Q2KSL3_E1B19K-02        --------------------------------SESRP-------------
Q2Y0J3_E1B19K-02        --------------------------------SESRP-------------
I1V161_E1B19K-02        --------------------------------SESRP-------------
Q6RK98_E1B19K-02        --------------------------------SESRP-------------
A0A5P8KYF0_E1B19K-      --------------------------------SESRP-------------
I6LEP5_E1B19K-02        --------------------------------SESRP-------------
I6LES1_E1B19K-02        --------------------------------SESRP-------------
J7I6Q4_E1B19K-02        --------------------------------SESRP-------------
J7I6S4_E1B19K-02        --------------------------------SESRP-------------
T1UF50_E1B19K-02        --------------------------------SESRP-------------
T1UJX4_E1B19K-02        --------------------------------SESRP-------------
A0A7G5FB98_E1B19K-      --------------------------------PESRP-------------
Q32UI6_E1B19K-02        --------------------------------PESRP-------------
J7I6W7_E1B19K-02        --------------------------------PESRP-------------
Q7T8D8_E1B19K-02        --------------------------------PESRP-------------
Q3ZL02_E1B19K-02        --------------------------------PESRP-------------
T1UFS4_E1B19K-02        --------------------------------PESRP-------------
W6EIX6_E1B19K-02        --------------------------------PESRP-------------
T1UE63_E1B19K-02        --------------------------------PESRP-------------
Q2KSG6_E1B19K-03        --------------------------------PESRP-------------
Q2KSM8_E1B19K-03        --------------------------------PESRP-------------
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        -----------------------MR-------------------------
Q71BY5_E1B19K-01        ----------------VSQIFPDSV-------------------------
Q71BY5_E1B19K-02        ----------------VSQIFPDSV-------------------------
P03248_E1B19K-03        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
D3JIR7_E1B19K-02        ----GHALDPEEG--------PSCA------------------AVNIKRE
A0A5H2QAX5_E1B19K-      ----GHEPDPDEG--------PSCA------------------VVKKRER
T1UEX7_E1B19K-02        ----GHEPDPDEG--------PSCA------------------VVKKRER
M0QU02_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTNGSIGA--RGVKRER
Q695T5_E1B19K-02        ----GPS---GGGVGGIPDPFPELALGAVGGASVVREDEEGRQRGQKREH
P04492_E1B19K-02        ----QVQEGH-------------VL------ERGEGPSCADDRDK-QEKK
A0MK43_E1B19K-02        ----GPSSGR-------------LG------AEDDPEEGTSGGAR-KKQK
A0A482EVC6_E1B19K-      ----GSSNG--------------IV------TEPDPEEGTSSGQRGEKRK
A0A7D0TLU2_E1B19K-      QSGLDPR---KCHLVHIPQWPPELR------RILTINEDGQGLKGVKRER
Q6VGV8_E1B19K-02        ----GPS---GMNVVQVAELYPELR------RILTITEDGQGLKGVKRER
A0A0G2R248_E1B19K-      ----GPS---GMNVVQVAELYPELR------RILTITEDGQGLKGVKRER
A0A4P2SGW2_E1B19K-      ----GPS---GMNVVQVAELYPELR------RILTITEDGQGLKGVKRER
E1ARN8_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
E1U5L6_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
J9Z5H0_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
J9Z4N4_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
T1UG63_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
J7I6T8_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
J9Z4H6_E1B19K-02        ----GPS---GMNVVQVAELFPELR------RILTINEDGQGLKGVKRER
T1UGY3_E1B19K-02        ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
A0A1P7YWR9_E1B19K-      ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
A0A1P7YWY2_E1B19K-      ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
A0A1P7YXN8_E1B19K-      ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
A0A1P8C849_E1B19K-      ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
T1UG22_E1B19K-02        ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
A0A1P7YYY5_E1B19K-      ----GPSVGRGAGLNEVSSLYPELS------KVLTSMA-----RGVKRER
M0QUW8_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QVP5_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
M0QUS9_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
T1UKQ0_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
M0QV47_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
T1UGU0_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
G1FBW4_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
F1DT57_E1B19K-02        ----GPSVGRGVGLNQVSSLYPELS------KVLTSMA-----RGVKRER
E9P585_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
T1UKP8_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
W8CZB0_E1B19K-02        ----GPSVGRGAGLNQVASLYPELS------KVLTTMA-----RGVKRER
T1ULJ8_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
M0QUB4_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
M0QVT4_E1B19K-02        ----GPSVGRGAGLNQVASLYPELS------KVLTTMA-----RGVKRER
M0QVG6_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UK99_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTTMA-----RGVKRER
C5HDR2_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A3S6PYX7_E1B19K-      ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A097I4T0_E1B19K-      ----GPSAGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QV87_E1B19K-02        ----GPSVGRGAGLSQVSSLYPELS------KVLTSMA-----RGVKRER
T1UKV6_E1B19K-02        ----GPSVGRGVGLNQVSSLYPELS------RVLTSMA-----RGVKRER
F8UFP5_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
T1UGT5_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A384ZUM9_E1B19K-      ----GPSVGRGAGLNQVASLYPELS------KVLTSMA-----RGVKRER
M0QUJ3_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UHQ8_E1B19K-02        ----GPSVGRGAGLNQVASLYPELS------KVLTTMA-----RGVKRER
T1UHH6_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UHL7_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A075TSZ1_E1B19K-      ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QVK6_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1ULP4_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
C4P207_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QUN2_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
E1AI10_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A384ZUF2_E1B19K-      ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UHG3_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QTS5_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
M0QV08_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
M0QU76_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QU41_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QVC7_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A3Q9FFS0_E1B19K-      ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UGX3_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
T1UHZ2_E1B19K-02        ----GPSVGRGAELNQVSSLYPELS------KVLTSMA-----RGVKRER
A0A0G2UY10_E1B19K-      ----GPSVGRGAGLNQVSSLYPELS------KVLTSMA-----RGVKRER
M0QUF3_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
G1FC01_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
G3CK71_E1B19K-02        ----GPSVGRGAGLNQVSSLYPELS------RVLTSMA-----RGVKRER
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        ----GPSGGGGGG---VADLFPELR------RVLTRSTTSGRDRGIKRER
Q5GFC7_E1B19K-03        ----GPS---GGG---VADLFPELH------RVLTRSS-SGRERGIKRER
Q6H1D7_E1B19K-02        ----GPS---GGG---VADLFPELH------RVLTRSS-SGRERGIKRER
R4HLE1_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
R4HLA0_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
J7ID56_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
Q5EY83_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
K7NG43_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
A0A0B4SJH1_E1B19K-      ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
A0A075IQ70_E1B19K-      ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
T1UIP3_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
Q2KRU2_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
Q2KS85_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
Q3ZKW2_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTSSGQDRGIKRER
R4HLJ6_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
R4HMC6_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
A0A897JQR0_E1B19K-      ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
Q2KSL3_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
Q2Y0J3_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
I1V161_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
Q6RK98_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
A0A5P8KYF0_E1B19K-      ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
I6LEP5_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
I6LES1_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
J7I6Q4_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
J7I6S4_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
T1UF50_E1B19K-02        ----GPS---GGG---VADLFPELR------RVLTRSTTSGQNRGIKRER
T1UJX4_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
A0A7G5FB98_E1B19K-      ----GPS-SGGGG---VADLSPELQ------RVLTGFTSTGRDRGVKRER
Q32UI6_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
J7I6W7_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
Q7T8D8_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
Q3ZL02_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
T1UFS4_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
W6EIX6_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
T1UE63_E1B19K-02        ----GPS-SGGGG---VADLSPELQ------RVLTGSTSTGRDRGVKRER
Q2KSG6_E1B19K-03        ----GPS--GGGG---VADLFPELR------RVLTRSL-SGRERGIKRER
Q2KSM8_E1B19K-03        ----GPS-GGGGG---VADLFPELR------RVLTRSL-SGRERGIKRER
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      ----GIYPLAAF--MDLRAELQTFE-------------------------
H9AAK5_E1B19K-01        ----GIYPLAAF--MDLRAELQTFE-------------------------
G0ZAH2_E1B19K-01        --------------MDLLKFLEDFE-------------------------
A0A3Q9HK00_E1B19K-      ----RGLILVTFDLMEAWECLEDFS-------------------------
A0A3Q9HK78_E1B19K-      ----RGLILVTFDLMEAWECLEDFS-------------------------
A0A3S9SPV1_E1B19K-      ----RGLILVTFDLMEAWECLEDFS-------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      ----MKRPVAAEVQMELDRLLENYN-------------------------
A0A0M3TH18_E1B19K-      ----MKRPVAAEVQMELDRLLENYN-------------------------
A0A097IW62_E1B19K-      --------------MDLDRVLENYN-------------------------
A0A0A1EUE4_E1B19K-      -----MGSESTSALMDLLGNLREFD-------------------------
A0A2H5AI40_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AID8_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AII9_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIL0_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIN5_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIS9_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIT6_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIU0_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A2H5AIC5_E1B19K-      -----MGSESTAALMDLLGNLREFD-------------------------
A0A0G2UY10_E1B19K-      ----TWAQTFREFLMDVWTILADFS-------------------------
X4Y9D2_E1B19K-01        ----TRAQTFREFLMDVWTILADFS-------------------------
C5HDR2_E1B19K-01        ----TWAQTFREFLMDVWTILADFS-------------------------
M0QVC7_E1B19K-01        ----TGAQTFRKFLMDVWTILADFS-------------------------
A0A3S6PYX7_E1B19K-      ----TWAQTFREFLMDVWTILADFS-------------------------
Q4KSL0_E1B19K-01        ----TGAQTFREFLMDVWTILADFS-------------------------
A0A1P7YYY5_E1B19K-      --------------MDVWSILGEFN-------------------------
A0A1P8C849_E1B19K-      --------------MDVWSILGEFN-------------------------
B9A5L5_E1B19K-01        --------------MDVWSILGEFN-------------------------
T1UGY3_E1B19K-01        --------------MDVWSILGEFN-------------------------
A0A1P7YWR9_E1B19K-      --------------MDVWSILGEFN-------------------------
A0A1P7YWY2_E1B19K-      --------------MDVWSILGEFN-------------------------
A0A1P7YXN8_E1B19K-      --------------MDVWSILGEFN-------------------------
B9A5A7_E1B19K-01        --------------MDVWSILGEFN-------------------------
T1UG22_E1B19K-01        --------------MDVWSILGEFN-------------------------
H5T740_E1B19K-01        --------------MEVWTILADFN-------------------------
A0A1J0MS84_E1B19K-      --------------MDVWTILADFS-------------------------
A0A097I4T0_E1B19K-      --------------MDVWTILADFS-------------------------
E5RWD9_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QU76_E1B19K-01        --------------MDVWTILADFS-------------------------
B9A5T7_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A7R6T9I9_E1B19K-      --------------MDVWTILADFS-------------------------
D3GBW3_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QUF3_E1B19K-01        --------------MDVWTILADFS-------------------------
E5RWL1_E1B19K-01        --------------MDVWTILADFS-------------------------
B6C6W8_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QU41_E1B19K-01        --------------MDVWTILADFS-------------------------
F1DT57_E1B19K-01        --------------MDVWTILADFS-------------------------
B2VQE3_E1B19K-01        --------------MDVWTILADFS-------------------------
B9A681_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A1Y1BYF1_E1B19K-      --------------MDVWTILADFS-------------------------
B6DU90_E1B19K-01        --------------MDVWTILADFS-------------------------
T1UHZ2_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A3Q9FFS0_E1B19K-      --------------MDVWSILADFS-------------------------
T1ULJ8_E1B19K-01        --------------MDVWTILADFS-------------------------
T1UHG3_E1B19K-01        --------------MDVWTILADFS-------------------------
E9P585_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A1Y1BXT7_E1B19K-      --------------MDVWTILADFS-------------------------
T1UHL7_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A075TSZ1_E1B19K-      --------------MDVWTILADFS-------------------------
T1UHH6_E1B19K-01        --------------MDVWTILADFS-------------------------
T1UKP8_E1B19K-01        --------------MDVWTILADFS-------------------------
B9A5Q1_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QUB4_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QUJ3_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QUN2_E1B19K-01        --------------MDVWTILADFS-------------------------
C4P207_E1B19K-01        --------------MDVWTILADFS-------------------------
E1CIM6_E1B19K-01        --------------MDVWTILADFS-------------------------
D4N3H6_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QVK6_E1B19K-01        --------------MDVWTILADFS-------------------------
M0QVT4_E1B19K-01        --------------MDVWTILADFS-------------------------
E1AI10_E1B19K-01        --------------MDVWTILADFS-------------------------
H0PPE7_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A3G8WIY5_E1B19K-      --------------MDVWTILADFS-------------------------
Q9YL99_E1B19K-01        --------------MDVWTILADFS-------------------------
K7ZLN6_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A384ZUF2_E1B19K-      --------------MDVWTILADFS-------------------------
A0A384ZUM9_E1B19K-      --------------MDVWTILADFS-------------------------
E1CIR1_E1B19K-01        --------------MDVWTILADFS-------------------------
T1UHQ8_E1B19K-01        --------------MDVWTILADFS-------------------------
T1ULP4_E1B19K-01        --------------MDVWTILADFS-------------------------
A0A291B0H2_E1B19K-      --------------MDVWTILGDFS-------------------------
W8VNG2_E1B19K-01        --------------MEVWTILGDFN-------------------------
F8UFP5_E1B19K-01        --------------MEVWTILADFN-------------------------
M0QV87_E1B19K-01        --------------MDVWTILGDFV-------------------------
M0QU02_E1B19K-01        --------------MDVWTILADFN-------------------------
T1UKV6_E1B19K-01        --------------MDVWTILGDFN-------------------------
M0QV47_E1B19K-01        --------------MEVWTILADFN-------------------------
M0QUW8_E1B19K-01        --------------MEVWTILADFN-------------------------
E1CIJ0_E1B19K-01        --------------MEVWTILADFN-------------------------
T1UGU0_E1B19K-01        --------------MEVWTILADFN-------------------------
M0QVG6_E1B19K-01        --------------MEVWTILADFS-------------------------
X4YVU5_E1B19K-01        --------------MEVWTILADFS-------------------------
M0QUS9_E1B19K-01        --------------MEVWTILADFN-------------------------
G1FBW4_E1B19K-01        --------------MEVWTILADFN-------------------------
M0QVP5_E1B19K-01        --------------MDVWTILADFN-------------------------
T1UKQ0_E1B19K-01        --------------MDVWTILADFN-------------------------
W8CZB0_E1B19K-01        --------------MEVWTILGDFN-------------------------
G1FC01_E1B19K-01        --------------MEVWTILGDFN-------------------------
G3CK71_E1B19K-01        --------------MEVWTILGDFN-------------------------
T1UGT5_E1B19K-01        --------------MEVWTILADFN-------------------------
T1UK99_E1B19K-01        --------------MEVWTILGDFN-------------------------
M0QTS5_E1B19K-01        --------------MEVWTILADFS-------------------------
M0QV08_E1B19K-01        --------------MEVWTILADFS-------------------------
G9JUV5_E1B19K-01        --------------MEVWTILADFS-------------------------
T1UGX3_E1B19K-01        --------------MDVWTILADFS-------------------------
Q7T951_E1B19K-01        --------------MEVWAILEDLR-------------------------
T1UE63_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q7T8D8_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q8B8U7_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q5UW22_E1B19K-01        --------------MEVWAILEDLR-------------------------
W6EIX6_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q3ZL02_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A1L7NRH1_E1B19K-      --------------MEVWAILEDLR-------------------------
T1UFS4_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q32UI6_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A7G5F9T0_E1B19K-      --------------MEVWAILEDLR-------------------------
C7SRS7_E1B19K-01        --------------MEVWAILEDLR-------------------------
J7H4R9_E1B19K-01        --------------MEVWAILEDLR-------------------------
D2DM83_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A7U3S1T6_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A7U3S224_E1B19K-      --------------MEVWAILEDLR-------------------------
J7I6W7_E1B19K-01        --------------MEVWAILEDLR-------------------------
T1UJX4_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A7G5FB98_E1B19K-      --------------MEVWAILEDLR-------------------------
T2CI10_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A0K0PX99_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A0K0PX35_E1B19K-      --------------MEVWAILEDLR-------------------------
J7ID56_E1B19K-01        --------------MEVWAILEDLK-------------------------
A0A0B4SJH1_E1B19K-      --------------MEVWAILEDLK-------------------------
A0A075IQ70_E1B19K-      --------------MEVWAILEDLK-------------------------
Q2KS85_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q3ZKW2_E1B19K-01        --------------MEVWAILEDLR-------------------------
K7NG43_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q2KRU2_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A8B0LCV0_E1B19K-      --------------MEVWAILEDLR-------------------------
T1UIP3_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A8B0L9Y2_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A6M6AA96_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A220VZ73_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A8B0LD36_E1B19K-      --------------MEVWAILEDLR-------------------------
A0A8B0LBX6_E1B19K-      --------------MEVWAILEDLR-------------------------
R4HLE1_E1B19K-01        --------------MEVWAILEDLR-------------------------
R4HMC6_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A897JQR0_E1B19K-      --------------MEVWAILEDLR-------------------------
I1V161_E1B19K-01        --------------MEVWAILEDLR-------------------------
P03248_E1B19K-02        --------------MEVWAILEDLR-------------------------
Q6RK98_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A5P8KYF0_E1B19K-      --------------MEVWAILEDLR-------------------------
J7I6Q4_E1B19K-01        --------------MEVWAILEDLR-------------------------
J7I6S4_E1B19K-01        --------------MEVWAILEDLR-------------------------
R4HLJ6_E1B19K-01        --------------MEVWAILEDLR-------------------------
R4HLA0_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q2KSL3_E1B19K-01        --------------MEVWAILEDLR-------------------------
Q2Y0J3_E1B19K-01        --------------MEVWAILEDLR-------------------------
A0A5J6CTQ0_E1B19K-      --------------MEVWAILEDLR-------------------------
Q5EY83_E1B19K-01        --------------MEVWAILEDLR-------------------------
I6LEP5_E1B19K-01        --------------MEVWAILEDLR-------------------------
I6LES1_E1B19K-01        --------------MEVWAILEDLR-------------------------
T1UF50_E1B19K-01        --------------MKVWAILEDLR-------------------------
Q6QPF3_E1B19K-01        --------------MEIWTVLEDFH-------------------------
Q6QPB7_E1B19K-01        --------------MEIWTVLEDFH-------------------------
Q6QPI9_E1B19K-01        --------------MEIWTVLEDFH-------------------------
P10406_E1B19K-01        --------------MEIWTVLEDFH-------------------------
Q5GFC7_E1B19K-02        --------------MEIWTVLEDFH-------------------------
A0A2R3WN62_E1B19K-      --------------MEIWTVLEDFH-------------------------
A0A3G9JTX5_E1B19K-      --------------MEIWTVLEDFY-------------------------
Q2KSM8_E1B19K-02        --------------MEIWTVLEDFY-------------------------
A0A2R3WNP3_E1B19K-      --------------MEIWTVLEDFY-------------------------
Q2KSG6_E1B19K-02        --------------MEIWTVLEDFY-------------------------
A0A2L1F392_E1B19K-      --------------MEIWTVLEDFY-------------------------
A0A3G9CMQ4_E1B19K-      --------------MEIWTVLEDFH-------------------------
Q5GFC7_E1B19K-01        --------------MEIWTVLEDFH-------------------------
Q5GFC8_E1B19K-01        --------------MEIWTVLEDFH-------------------------
Q6H1D7_E1B19K-01        --------------MEIWTVLEDFH-------------------------
A0A3G8W6L2_E1B19K-      --------------MEIWTVLEDFY-------------------------
A0A3G9K5X3_E1B19K-      --------------MEIWTVLEDFY-------------------------
Q2KSG6_E1B19K-01        --------------MEIWTVLEDFY-------------------------
Q2KSM8_E1B19K-01        --------------MEIWTVLEDFY-------------------------
A0A2R3WN16_E1B19K-      --------------MEIWTVLEDFY-------------------------
G9G841_E1B19K-01        --------------MEIWTILEDLH-------------------------
Q8UY91_E1B19K-01        --------------MEIWTVLEDFH-------------------------
D3JIR7_E1B19K-01        --------------MELEAVLQSYQ-------------------------
A0A076V686_E1B19K-      --------------MELEAVLQSYQ-------------------------
A0A5H2QAX5_E1B19K-      --------------MELEAVLQSFQ-------------------------
G1DE13_E1B19K-01        --------------MELEAVLQSFQ-------------------------
D0Z5R9_E1B19K-01        --------------MELEAVLQSFQ-------------------------
T1UEX7_E1B19K-01        --------------MELEAVLQSFQ-------------------------
A0A3G8WH01_E1B19K-      --------------MELETVLQSFQ-------------------------
P04492_E1B19K-01        --------------MELETVLQSFQ-------------------------
A0A2H5AI99_E1B19K-      --------------MDLLKELRDFD-------------------------
A0A0M3TH31_E1B19K-      --------------MDLLRLLSDYE-------------------------
M9YXY5_E1B19K-01        --------------MDLLRLLSDYE-------------------------
M9YVF6_E1B19K-01        --------------MDLLRLLSDYE-------------------------
A0MK43_E1B19K-01        --------------MDLLGNLREFD-------------------------
A0A2H5AI21_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A0M5L3Y4_E1B19K-      --------------MDLLGDLREFG-------------------------
Q5C8R2_E1B19K-01        --------------MDLLGDLREFG-------------------------
A0A0A1EUB2_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A0A1EUC8_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A2H5AI04_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A2H5AI72_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A2H5AIL3_E1B19K-      --------------MDLLGDLREFG-------------------------
A0A2H4CJZ0_E1B19K-      --------------MEFWSELQNYQ-------------------------
H8PFZ1_E1B19K-01        --------------MEYWSELQNYQ-------------------------
A0A7U3RVU4_E1B19K-      --------------MELWSELQSYE-------------------------
A0A142G3J2_E1B19K-      --------------MELWSELQSYQ-------------------------
P10543_E1B19K-01        --------------MELWSELQSYQ-------------------------
A0A6M6AEV2_E1B19K-      --------------MELWSELQSYQ-------------------------
A0A7U3RWV6_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A1S6ELT2_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A3G4W995_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A898KBW7_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A482EVC6_E1B19K-      --------------MEFWSELQSYQ-------------------------
B5SNR1_E1B19K-01        --------------MEFWSELQSYQ-------------------------
P10544_E1B19K-01        --------------MEFWSELQSYQ-------------------------
W0S1G8_E1B19K-01        --------------MEFWSELQSYQ-------------------------
A0A3G8W407_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A898KBS1_E1B19K-      --------------MEFWSELQSYQ-------------------------
F4ZCJ8_E1B19K-01        --------------MEFWSELQSYQ-------------------------
A0A898KBR0_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A6B9DS29_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A6M6AES6_E1B19K-      --------------MEFWSELQSYQ-------------------------
A0A7L4WGT1_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3S9SP19_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A291P1B2_E1B19K-      --------------METWECLEDFS-------------------------
A0A5K6WAR5_E1B19K-      --------------MEAWECLEDFF-------------------------
T1UG63_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A1U9ALK7_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A6M5E4Y6_E1B19K-      --------------MEAWECLEDFS-------------------------
P03247_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A3G8W3H5_E1B19K-      --------------MEAWECLEDFS-------------------------
E1U5L6_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A516UYI9_E1B19K-      --------------MEAWECLEDFS-------------------------
J9Z5H0_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A3S9SND6_E1B19K-      --------------MEAWECLEDFS-------------------------
J9Z4N4_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A3Q9HJZ5_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A513TZR1_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A516UYM9_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A7L4WG90_E1B19K-      --------------MEAWECLEDFS-------------------------
J9Z4H6_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A6M4W5T4_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A7L4WIG2_E1B19K-      --------------MEAWECLEDFS-------------------------
J7I6T8_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A7L4WK62_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3S9SNH4_E1B19K-      --------------MEAWECLEDFS-------------------------
Q6WQ37_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A7D0TN91_E1B19K-      ----RGLILVTSDLMEAWECLEDFS-------------------------
Q6VGV8_E1B19K-01        --------------MEAWECLEDFS-------------------------
A0A0G2R248_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3Q9HJ54_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3S9SSS2_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3S9SNY0_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A2H4PJ75_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A7D6TSN5_E1B19K-      --------------MEAWECLEDFS-------------------------
Q71BY5_E1B19K-04        --------------MEAWECLEDFS-------------------------
A0A4P2SGW2_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3Q9HJ63_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A7L4WIC2_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A7L4WJT1_E1B19K-      --------------MEAWECLEDFS-------------------------
A0A3Q9HLF7_E1B19K-      --------------MEAWECLEDFS-------------------------
E1ARN8_E1B19K-01        --------------MEAWECLEDFS-------------------------
P06501_E1B19K-01        --------------MDLRTALQTFE-------------------------
A0A0M4N3Z1_E1B19K-      --------------MDLRTALQTFE-------------------------
Q8B6X5_E1B19K-01        --------------MDLRTALQTFE-------------------------
H9AAD9_E1B19K-01        --------------MDLRAELQTFE-------------------------
H9AAH3_E1B19K-01        --------------MDLRAELQTFE-------------------------
H9AAA8_E1B19K-01        --------------MDLRVELQTFE-------------------------
M9YVA3_E1B19K-01        --------------MDLRVELQTFE-------------------------
F2WTJ7_E1B19K-01        ----GAAVGLGHFTMDLRVELQTFE-------------------------
F2WTM9_E1B19K-01        ----GAAVGLGHFTMNLRVELQTFE-------------------------
H9AA76_E1B19K-01        ----GVVVRLGHFTMDLRVELQTFE-------------------------
A0A1C8EG46_E1B19K-      ----GAVVRLGHFTMDLRVELQTFE-------------------------
H9AAN8_E1B19K-01        ----GAVVRLGHFTMDLRVELQTFE-------------------------
H9AAS0_E1B19K-01        ----GAVVRLGHFTMDLRVELQTFE-------------------------
H9AAV3_E1B19K-01        ----GAVVRLGHFTMDLRVELQTFE-------------------------
H9AAY5_E1B19K-01        ----GAVVRLGHFTMDLRVELQTFE-------------------------
A0A1L3INW0_E1B19K-      --------------MDLYKSLEDRS-------------------------
F6KST6_E1B19K-01        --------------MDLYESLENLG-------------------------
F2WTG5_E1B19K-01        --------------MDLYESLENLS-------------------------
Q695T5_E1B19K-01        --------------MDLYESLENLS-------------------------
H9TER0_E1B19K-01        --------------MDLYESLENLS-------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        ---------------------------------------MLAAQEGIDLL
Q71BY5_E1B19K-02        ---------------------------------------MLAAQEGIDLL
P03248_E1B19K-03        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
D3JIR7_E1B19K-02        ----RETVLSRLAVNIMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQL
A0A5H2QAX5_E1B19K-      KESLKEAVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQL
T1UEX7_E1B19K-02        KESLKETVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQL
M0QU02_E1B19K-02        SDGGNTGMMTELTASLMNRKRPECITWHELQMECRDEVGLMQDKYGLEQI
Q695T5_E1B19K-02        FES--STFLADVTVALMAKNRLEVVWYPEVWEDFEKGDLHLLEKYNFEQV
P04492_E1B19K-02        ESLKEAAVLSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQL
A0MK43_E1B19K-02        TEPEPRNFLNELTVSLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQL
A0A482EVC6_E1B19K-      LENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQL
A0A7D0TLU2_E1B19K-      GASEATEEVRNLTFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQL
Q6VGV8_E1B19K-02        GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
A0A0G2R248_E1B19K-      GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
A0A4P2SGW2_E1B19K-      GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
E1ARN8_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
E1U5L6_E1B19K-02        GASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z5H0_E1B19K-02        GASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z4N4_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
T1UG63_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J7I6T8_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z4H6_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
T1UGY3_E1B19K-02        SDGGNTGLMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YWR9_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YWY2_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YXN8_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P8C849_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UG22_E1B19K-02        SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YYY5_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUW8_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVP5_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUS9_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UKQ0_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QV47_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UGU0_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
G1FBW4_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
F1DT57_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
E9P585_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1UKP8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
W8CZB0_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1ULJ8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUB4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVT4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVG6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UK99_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
C5HDR2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A3S6PYX7_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A097I4T0_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QV87_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQI
T1UKV6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQI
F8UFP5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQI
T1UGT5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQI
A0A384ZUM9_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUJ3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEIGLMQDKYGLEQI
T1UHQ8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UHH6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1UHL7_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
A0A075TSZ1_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QVK6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1ULP4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
C4P207_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
M0QUN2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
E1AI10_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
A0A384ZUF2_E1B19K-      SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
T1UHG3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
M0QTS5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QV08_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QU76_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QU41_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QVC7_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A3Q9FFS0_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
T1UGX3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
T1UHZ2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A0G2UY10_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QUF3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
G1FC01_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
G3CK71_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
I6LEP5_E1B19K-03        ----------------MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LES1_E1B19K-03        ----------------MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T2CI10_E1B19K-02        NPSGTNP-RSELALSLMSRRRPETIWWHEVQNEGRDEVSILQEKYSLEQV
Q5GFC7_E1B19K-03        HDE-TNH-RIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQV
Q6H1D7_E1B19K-02        HDE-TNH-RIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQV
R4HLE1_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HLA0_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7ID56_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q5EY83_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
K7NG43_E1B19K-02        NPSGNNL-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A0B4SJH1_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A075IQ70_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UIP3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KRU2_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KS85_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q3ZKW2_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HLJ6_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HMC6_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A897JQR0_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KSL3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2Y0J3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I1V161_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q6RK98_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A5P8KYF0_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LEP5_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LES1_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7I6Q4_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7I6S4_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UF50_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UJX4_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
A0A7G5FB98_E1B19K-      ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q32UI6_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
J7I6W7_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q7T8D8_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q3ZL02_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
T1UFS4_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
W6EIX6_E1B19K-02        ACSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
T1UE63_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q2KSG6_E1B19K-03        HDE-TNH-RTELTVGLMSRKRPETVWWHEVQMTGTDEVSVMHEKFSLEQV
Q2KSM8_E1B19K-03        HDE-TNH-RTELTVGLMSRKRPETVWWHEVQLTGTDEVSVMHEKFSLEQV
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        TF----PPAPGSPEPPHLSRQPEQPE------------------------
Q71BY5_E1B19K-02        TF----PPAPGSPEPPHLSRQPEQPE------------------------
P03248_E1B19K-03        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
D3JIR7_E1B19K-02        KTHWLEPWEDIESAIKTFAKLALRPDRSYKISKTITIASYAYIIGNGAII
A0A5H2QAX5_E1B19K-      KTHWLEPWEDLECAIKAFAKVALRPDCTYKISKTVTITSCTYIIGNGAVV
T1UEX7_E1B19K-02        KTHWLEPWEDLECAIKAFAKVALRPDCTYKISKTVTITSCTYIIGNGAVV
M0QU02_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEV
Q695T5_E1B19K-02        KTYWMNPDEDWEVVLNRYGKVALRPDCRYQVRDKVVLRRNVYLLGNGATV
P04492_E1B19K-02        KTHWLEPWEDMECAIKAFAKLALRPDCSYRITKTVTITSCAYIIGNGAEV
A0MK43_E1B19K-02        KTHWLEPWEDMEMALDTFAKVALRPDKVYTIRRTVNIKKSVYVIGHGALV
A0A482EVC6_E1B19K-      KTHWMEPWEDWELALNMFAKVALRPDTIYTIKKTVNIRKCAYVIGNGAVV
A0A7D0TLU2_E1B19K-      TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
Q6VGV8_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
A0A0G2R248_E1B19K-      TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
A0A4P2SGW2_E1B19K-      TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
E1ARN8_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
E1U5L6_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
J9Z5H0_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
J9Z4N4_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
T1UG63_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
J7I6T8_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
J9Z4H6_E1B19K-02        TTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV
T1UGY3_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
A0A1P7YWR9_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
A0A1P7YWY2_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
A0A1P7YXN8_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
A0A1P8C849_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
T1UG22_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
A0A1P7YYY5_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYISGNGAEV
M0QUW8_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTINIRHACYISGNGAEV
M0QVP5_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEV
M0QUS9_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
T1UKQ0_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
M0QV47_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
T1UGU0_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
G1FBW4_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
F1DT57_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
E9P585_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1UKP8_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEV
W8CZB0_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEV
T1ULJ8_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEV
M0QUB4_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEV
M0QVT4_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYISGNGAEV
M0QVG6_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYKVTKTVNIRHACYISGNGAEV
T1UK99_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYISGNGAEV
C5HDR2_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEV
A0A3S6PYX7_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEV
A0A097I4T0_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYISGNGAEV
M0QV87_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
T1UKV6_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
F8UFP5_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
T1UGT5_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
A0A384ZUM9_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
M0QUJ3_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
T1UHQ8_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1UHH6_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1UHL7_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
A0A075TSZ1_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
M0QVK6_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1ULP4_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
C4P207_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
M0QUN2_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
E1AI10_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
A0A384ZUF2_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1UHG3_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
M0QTS5_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEV
M0QV08_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEV
M0QU76_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
M0QU41_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
M0QVC7_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
A0A3Q9FFS0_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
T1UGX3_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYISGNGAEV
T1UHZ2_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYISGNGAEV
A0A0G2UY10_E1B19K-      KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
M0QUF3_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
G1FC01_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
G3CK71_E1B19K-02        KTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYISGNGAEV
I6LEP5_E1B19K-03        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
I6LES1_E1B19K-03        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
T2CI10_E1B19K-02        KTCWLEPEDDWEVAIRNYAKIALRPDKLYRITKRINIRNACYISGNGAEV
Q5GFC7_E1B19K-03        KTCWLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEV
Q6H1D7_E1B19K-02        KTCWLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEV
R4HLE1_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
R4HLA0_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
J7ID56_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q5EY83_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
K7NG43_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYILGNGAEV
A0A0B4SJH1_E1B19K-      KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
A0A075IQ70_E1B19K-      KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
T1UIP3_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q2KRU2_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q2KS85_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q3ZKW2_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
R4HLJ6_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
R4HMC6_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
A0A897JQR0_E1B19K-      KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q2KSL3_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q2Y0J3_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
I1V161_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
Q6RK98_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
A0A5P8KYF0_E1B19K-      KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
I6LEP5_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
I6LES1_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
J7I6Q4_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
J7I6S4_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
T1UF50_E1B19K-02        KTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNGAEV
T1UJX4_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
A0A7G5FB98_E1B19K-      KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
Q32UI6_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
J7I6W7_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
Q7T8D8_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
Q3ZL02_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
T1UFS4_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
W6EIX6_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISGNGAEV
T1UE63_E1B19K-02        KTCWLEPEDDWEVAIKNYAKIALRPDKQYKISRRINIRNACYISGNGAEV
Q2KSG6_E1B19K-03        KTCWLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEV
Q2KSM8_E1B19K-03        KTCWLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEV
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        -----QRALGPVSMPNLVPEVIDLTC------------------------
Q71BY5_E1B19K-02        -----QRALGPVSMPNLVPEVIDLTC------------------------
P03248_E1B19K-03        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
D3JIR7_E1B19K-02        EVDTSDRVAFRCRMQGMGPGVVGLGGITFINVRFAGDKFKGTLFEANTSL
A0A5H2QAX5_E1B19K-      EVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEANTSV
T1UEX7_E1B19K-02        EVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEANTSV
M0QU02_E1B19K-02        VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
Q695T5_E1B19K-02        EMVDPRRGGFVANMQEMCPGVVGLSGVTFHSVRFSGSNFGGVVITANTPV
P04492_E1B19K-02        EVDTSDRVAFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANTCL
A0MK43_E1B19K-02        QVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSVFVTSTQL
A0A482EVC6_E1B19K-      RFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFASTTQL
A0A7D0TLU2_E1B19K-      EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
Q6VGV8_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
A0A0G2R248_E1B19K-      EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
A0A4P2SGW2_E1B19K-      EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
E1ARN8_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
E1U5L6_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
J9Z5H0_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
J9Z4N4_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
T1UG63_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
J7I6T8_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
J9Z4H6_E1B19K-02        EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNL
T1UGY3_E1B19K-02        DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
A0A1P7YWR9_E1B19K-      DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
A0A1P7YWY2_E1B19K-      DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
A0A1P7YXN8_E1B19K-      DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
A0A1P8C849_E1B19K-      DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
T1UG22_E1B19K-02        DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
A0A1P7YYY5_E1B19K-      DIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMANSHM
M0QUW8_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
M0QVP5_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
M0QUS9_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
T1UKQ0_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
M0QV47_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
T1UGU0_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
G1FBW4_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
F1DT57_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
E9P585_E1B19K-02        VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UKP8_E1B19K-02        MIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
W8CZB0_E1B19K-02        MIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMTNSHM
T1ULJ8_E1B19K-02        VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QUB4_E1B19K-02        MIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QVT4_E1B19K-02        MIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QVG6_E1B19K-02        VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UK99_E1B19K-02        VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
C5HDR2_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A3S6PYX7_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A097I4T0_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QV87_E1B19K-02        VVDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UKV6_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMANSHM
F8UFP5_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UGT5_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A384ZUM9_E1B19K-      VIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QUJ3_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMANSHM
T1UHQ8_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UHH6_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UHL7_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A075TSZ1_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QVK6_E1B19K-02        IIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1ULP4_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
C4P207_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QUN2_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
E1AI10_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A384ZUF2_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UHG3_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QTS5_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QV08_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QU76_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QU41_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
M0QVC7_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A3Q9FFS0_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UGX3_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
T1UHZ2_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMANSHM
A0A0G2UY10_E1B19K-      VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMANSHM
M0QUF3_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMANSHM
G1FC01_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMANSHM
G3CK71_E1B19K-02        VIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMANSHM
I6LEP5_E1B19K-03        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
I6LES1_E1B19K-03        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
T2CI10_E1B19K-02        VIDTQDRTVFRCCMMGMWPGVVGMEAVTLMNVKFRGDGYNGVVFMANTKL
Q5GFC7_E1B19K-03        EICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMANTKL
Q6H1D7_E1B19K-02        EICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMANTKL
R4HLE1_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
R4HLA0_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
J7ID56_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
Q5EY83_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAITLMNIRFRGDGYNGIVFMANTKL
K7NG43_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFRGDGYNGIVFMANTKL
A0A0B4SJH1_E1B19K-      IIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
A0A075IQ70_E1B19K-      IIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
T1UIP3_E1B19K-02        IIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
Q2KRU2_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
Q2KS85_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
Q3ZKW2_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMANTKL
R4HLJ6_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
R4HMC6_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
A0A897JQR0_E1B19K-      IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
Q2KSL3_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
Q2Y0J3_E1B19K-02        IIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGDGYNGIVFMANTKL
I1V161_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
Q6RK98_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
A0A5P8KYF0_E1B19K-      IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
I6LEP5_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
I6LES1_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
J7I6Q4_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
J7I6S4_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
T1UF50_E1B19K-02        IIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMANTKL
T1UJX4_E1B19K-02        VIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
A0A7G5FB98_E1B19K-      VIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
Q32UI6_E1B19K-02        VIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
J7I6W7_E1B19K-02        VIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
Q7T8D8_E1B19K-02        VIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
Q3ZL02_E1B19K-02        VIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
T1UFS4_E1B19K-02        VIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
W6EIX6_E1B19K-02        VIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
T1UE63_E1B19K-02        VIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMANTKL
Q2KSG6_E1B19K-03        EICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRFRGDGYNGTV-MANTKL
Q2KSM8_E1B19K-03        EICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRFRGDGYNGTVFMANTKL
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --HEAGFPPSDDEDEEGEEFVLDYVEQPGHGCRSCHYHRRNTGDPDIMCS
Q71BY5_E1B19K-02        --HEAGFPPSDDEDEEG---------------------------------
P03248_E1B19K-03        ILHGCRFFGFNNTCEEA---------------------------------
D3JIR7_E1B19K-02        VLHGVYFLNFSNTCVES----WIKVSARGCTFYGCRRGLVGRPKSKMSVK
A0A5H2QAX5_E1B19K-      VLHGVYFLNFNNTCVEC----WNKVSARGCTFYGCWKALVGRPKSKMSVK
T1UEX7_E1B19K-02        VLHGVYFLNFNNTCVEC----WNKVSARGCTFYGCWKALVGRPKSKMSVK
M0QU02_E1B19K-02        TLHGCKFFGFNNMCAEV----WGSAKIRGCVYYGCWMGVVGRPKSEMSVK
Q695T5_E1B19K-02        VLHNCYFFGFSNTCVEM----RVGGKVRGCSFYACWKGVVSQGKAKVSVH
P04492_E1B19K-02        VLHGVYFLNFSNICVES----WNKVSARGCTFYGCWKGLVGRPKSKLSVK
A0MK43_E1B19K-02        TLHGVYFFNFNNTCVES----WGRVSLRGCSFHGCWKAVVGRIKSVMSVK
A0A482EVC6_E1B19K-      TLHGVFFQNCSGVCVDS----WGRVSARGCTFVGCWKGLVGQNKSQMSVK
A0A7D0TLU2_E1B19K-      ILHGPGFHRFVNTCIEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
Q6VGV8_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
A0A0G2R248_E1B19K-      ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
A0A4P2SGW2_E1B19K-      ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
E1ARN8_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
E1U5L6_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
J9Z5H0_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
J9Z4N4_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
T1UG63_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
J7I6T8_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
J9Z4H6_E1B19K-02        ILHGVSFYGFNNTCVEA----WTDVRVRGCAFYCCWKGVVCRPKSRASIK
T1UGY3_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A1P7YWR9_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A1P7YWY2_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A1P7YXN8_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A1P8C849_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UG22_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A1P7YYY5_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QUW8_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QVP5_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFFGCWMGVVGRPKSEMSVK
M0QUS9_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UKQ0_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QV47_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UGU0_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
G1FBW4_E1B19K-02        TLHGCNFFGFNNMCAEV----WGASKIRGCKFFGCWMGVVGRPKSEMSVK
F1DT57_E1B19K-02        TLHGCDFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
E9P585_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UKP8_E1B19K-02        TVHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
W8CZB0_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1ULJ8_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QUB4_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QVT4_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QVG6_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UK99_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
C5HDR2_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKVRGCKFYGCWMGVVGRPKSEMSVK
A0A3S6PYX7_E1B19K-      TLHGCSFFGFNNMCAEV----WGASKVRGCKFYGCWMGVVGRPKSEMSVK
A0A097I4T0_E1B19K-      TLHGCSFFGFNNMCAEV----WGASKVRGCKFYGCWMGVVGRPKSEMSVK
M0QV87_E1B19K-02        TVHGCSFFGFNNMCAEI----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UKV6_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
F8UFP5_E1B19K-02        TLHGCDFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UGT5_E1B19K-02        TLHGCDFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A384ZUM9_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QUJ3_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UHQ8_E1B19K-02        TLHGCDFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UHH6_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1UHL7_E1B19K-02        TLHGCNFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
A0A075TSZ1_E1B19K-      TLHGCNFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QVK6_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
T1ULP4_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
C4P207_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QUN2_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
E1AI10_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
A0A384ZUF2_E1B19K-      TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UHG3_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QTS5_E1B19K-02        TLHGCDFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QV08_E1B19K-02        TLHGCDFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QU76_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QU41_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
M0QVC7_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
A0A3Q9FFS0_E1B19K-      TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UGX3_E1B19K-02        TLHGCDFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
T1UHZ2_E1B19K-02        TLHGCSFFGFNNMCAEV----WGASKIRGCKFYGCWMGVVGRPKSEMSVK
A0A0G2UY10_E1B19K-      TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
M0QUF3_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
G1FC01_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
G3CK71_E1B19K-02        TLHGCSFFGFNNMCAEV----WGAAKIRGCKFYGCWMGVVGRPKSEMSVK
I6LEP5_E1B19K-03        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
I6LES1_E1B19K-03        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
T2CI10_E1B19K-02        ILHGCSFFGFNNICVEA----WGQVSVRGCSFYACWIATSGRTKSQLSVK
Q5GFC7_E1B19K-03        TVHGCSFFGFNNTCIEA----WGQVGVKGCSFSANWMGVVGRTKSMLSVK
Q6H1D7_E1B19K-02        TVHGCSFFGFNNTCIEA----WGQVGVKGCSFSANWMGVVGRTKSMLSVK
R4HLE1_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
R4HLA0_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
J7ID56_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q5EY83_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
K7NG43_E1B19K-02        ILHGCSFFGVNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSAK
A0A0B4SJH1_E1B19K-      ILHGCSLFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
A0A075IQ70_E1B19K-      ILHGCSLFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
T1UIP3_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q2KRU2_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q2KS85_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVGVRGCSFYACWIATSGRVKSQLSVK
Q3ZKW2_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVGVRGCSFYACWIATSGRVKSQLSVK
R4HLJ6_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
R4HMC6_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
A0A897JQR0_E1B19K-      ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q2KSL3_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q2Y0J3_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
I1V161_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
Q6RK98_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
A0A5P8KYF0_E1B19K-      ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
I6LEP5_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
I6LES1_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
J7I6Q4_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
J7I6S4_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
T1UF50_E1B19K-02        ILHGCSFFGFNNTCVEA----WGQVSVRGCSFYACWIATSGRVKSQLSVK
T1UJX4_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
A0A7G5FB98_E1B19K-      ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
Q32UI6_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
J7I6W7_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
Q7T8D8_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
Q3ZL02_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
T1UFS4_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
W6EIX6_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFCACWIATAGRTKSQLSLK
T1UE63_E1B19K-02        ILHGCSFFGFNNTCVDA----WGQVSVRGCSFYACWIATAGRTKSQLSLK
Q2KSG6_E1B19K-03        TVHGCSFFGFNNTCIEA----WGHVGVRGCSFSANWMGVVGRTKSMLSVK
Q2KSM8_E1B19K-03        TVHGCSFFGFNNTCIEA----WGHVGVRGCSFSANWMGVVGRTKSMLSVK
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        LCYMRTCGMFVYSPVSEPEPEPEPEPEPARPARRPKMVPAILRRPTSPVS
Q71BY5_E1B19K-02        -------------PVSEPEPEPEPEPEPARPARRPKMVPAILRRPTSPVS
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        KCLFEKCVLALIV---------EGDAHIRHNAASENTCFVLVKGMAVLRH
A0A5H2QAX5_E1B19K-      KCLFEKCVLALIV---------EGDAHIRHNAASENTCFILLKGMAILKH
T1UEX7_E1B19K-02        KCLFEKCVLALIV---------EGDAHIRHNAASENTCFILLKGMAILKH
M0QU02_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSIETGCFCLVKGTASLKH
Q695T5_E1B19K-02        KCMLERCTLGISS---------EGFLHAGDNVASDNGCAFLIKGGGRICH
P04492_E1B19K-02        KCLFEKCVLAILN---------EGDAHIRHNAASENACFVLLKGMAILKH
A0MK43_E1B19K-02        KCIFERCVIALAV---------EGYGRIRNNAASENGCFLLLKGTASVKH
A0A482EVC6_E1B19K-      KCVFERCILAMVV---------EGQARIRHNAGSENVCFLLLKGTASVKH
A0A7D0TLU2_E1B19K-      KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
Q6VGV8_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
A0A0G2R248_E1B19K-      KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
A0A4P2SGW2_E1B19K-      KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
E1ARN8_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
E1U5L6_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
J9Z5H0_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
J9Z4N4_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
T1UG63_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
J7I6T8_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
J9Z4H6_E1B19K-02        KCLFERCTLGILS---------EGNSRVRHNVASDCGCFMLVKSVAVIKH
T1UGY3_E1B19K-02        QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YWR9_E1B19K-      QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YWY2_E1B19K-      QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YXN8_E1B19K-      QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P8C849_E1B19K-      QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
T1UG22_E1B19K-02        QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
A0A1P7YYY5_E1B19K-      QCVFEKCYLGVCT---------EGNARVRHCSSLETGCFCLVKGTASIKH
M0QUW8_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
M0QVP5_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
M0QUS9_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
T1UKQ0_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
M0QV47_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
T1UGU0_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
G1FBW4_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
F1DT57_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
E9P585_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
T1UKP8_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
W8CZB0_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
T1ULJ8_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
M0QUB4_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
M0QVT4_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
M0QVG6_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
T1UK99_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASIKH
C5HDR2_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASIKH
A0A3S6PYX7_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASIKH
A0A097I4T0_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASIKH
M0QV87_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
T1UKV6_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
F8UFP5_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
T1UGT5_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSMETGCFCLVKGTASIKH
A0A384ZUM9_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QUJ3_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
T1UHQ8_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
T1UHH6_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSMETGCFCLVKGTASLKH
T1UHL7_E1B19K-02        QCVFEKCYLAVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
A0A075TSZ1_E1B19K-      QCVFEKCYLAVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QVK6_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
T1ULP4_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSMETGCFCLVKGTASLKH
C4P207_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QUN2_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
E1AI10_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
A0A384ZUF2_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
T1UHG3_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QTS5_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QV08_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QU76_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASLKH
M0QU41_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASLKH
M0QVC7_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASLKH
A0A3Q9FFS0_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASLKH
T1UGX3_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
T1UHZ2_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLDTGCFCLVKGTASLKH
A0A0G2UY10_E1B19K-      QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
M0QUF3_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
G1FC01_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
G3CK71_E1B19K-02        QCVFEKCYLGVST---------EGNARVRHCSSLETGCFCLVKGTASLKH
I6LEP5_E1B19K-03        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
I6LES1_E1B19K-03        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
T2CI10_E1B19K-02        KCMFERCNLGILN---------EGEARVSHCASSETGCFILIKGNANVKH
Q5GFC7_E1B19K-03        KCLFERCHLGVMS---------EGEARIRHCASTETGCFVLCKGNAKIKH
Q6H1D7_E1B19K-02        KCLFERCHLGVMS---------EGEARIRHCASTETGCFVLCKGNAKIKH
R4HLE1_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
R4HLA0_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATQTGCFILIKGNASVKH
J7ID56_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATQTGCFILIKGNASVKH
Q5EY83_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETACFILIKGNASVKH
K7NG43_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
A0A0B4SJH1_E1B19K-      KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
A0A075IQ70_E1B19K-      KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
T1UIP3_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
Q2KRU2_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
Q2KS85_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
Q3ZKW2_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
R4HLJ6_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
R4HMC6_E1B19K-02        KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
A0A897JQR0_E1B19K-      KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
Q2KSL3_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
Q2Y0J3_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
I1V161_E1B19K-02        KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
Q6RK98_E1B19K-02        KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
A0A5P8KYF0_E1B19K-      KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
I6LEP5_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
I6LES1_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
J7I6Q4_E1B19K-02        KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
J7I6S4_E1B19K-02        KCMFERCNLGILN---------EGEARIRHCAATETGCFILIKGNASVKH
T1UF50_E1B19K-02        KCMFERCNLGILN---------EGEARVRHCAATETGCFILIKGNASVKH
T1UJX4_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
A0A7G5FB98_E1B19K-      KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
Q32UI6_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
J7I6W7_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
Q7T8D8_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
Q3ZL02_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
T1UFS4_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
W6EIX6_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
T1UE63_E1B19K-02        KCIFQRCNLGILN---------EGEARVRHCASTDTGCFILIKGNASVKH
Q2KSG6_E1B19K-03        KCLFERCHLGVMS---------EGEARIRHCASTETGCFVLCKGNAKIKH
Q2KSM8_E1B19K-03        KCLFERCHLGVMS---------EGEARIRHCASTETGCFVLCKGNAKIKH
Q7T8D8_E1B19K-03        ---------------------------MSGNASFKGGVFSPYLTGRLP--
Q6RK98_E1B19K-03        ---------------------------MSGSASFEGGVFSPYLTGRLP--
A0A0M4NHE0_E1B19K-      ----------------------STRRLVELCSNRSSWFGRFLFGSTLC--
H9AAK5_E1B19K-01        ----------------------STRRLVELCSNRSSWFGRFLFGSTLC--
G0ZAH2_E1B19K-01        ----------------------NCRQVLQQASKRTGGWSRWLLGNQLV--
A0A3Q9HK00_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3Q9HK78_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SPV1_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
Q2KSM8_E1B19K-04        ---------------------------MESRNPFQQGLPVGFLSSSFVES
Q2KSG6_E1B19K-04        ---------------------------MESRNPFQQGLPVGFLSSSFVES
Q5GFC7_E1B19K-04        ---------------------------MESRNPFQQGLPAGFLSSSFVEN
E1U5L6_E1B19K-03        ---------------------------MERRNPSERGVPAGFSGHASVES
E1ARN8_E1B19K-03        ---------------------------MERRNPSERGVPAGFSGHAFVES
A0A1W5PVU4_E1B19K-      ----------------------SLRRVLEEASEDTSVWWRRLFGCRVS--
A0A0M3TH18_E1B19K-      ----------------------SLRRVLEEASEDTSVWWRKLFGCRVS--
A0A097IW62_E1B19K-      ----------------------SLRKVVEEASEQTSGWWRKLFGCRLS--
A0A0A1EUE4_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AI40_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AID8_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AII9_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIL0_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIN5_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIS9_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIT6_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIU0_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AIC5_E1B19K-      ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A0G2UY10_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
X4Y9D2_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
C5HDR2_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QVC7_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A3S6PYX7_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
Q4KSL0_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1P7YYY5_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1P8C849_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B9A5L5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UGY3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1P7YWR9_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1P7YWY2_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1P7YXN8_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B9A5A7_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UG22_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
H5T740_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLA--
A0A1J0MS84_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A097I4T0_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E5RWD9_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QU76_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B9A5T7_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A7R6T9I9_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
D3GBW3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QUF3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E5RWL1_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B6C6W8_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QU41_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
F1DT57_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B2VQE3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B9A681_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1Y1BYF1_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B6DU90_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UHZ2_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A3Q9FFS0_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1ULJ8_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UHG3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E9P585_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A1Y1BXT7_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UHL7_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A075TSZ1_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UHH6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UKP8_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
B9A5Q1_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QUB4_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QUJ3_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QUN2_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
C4P207_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E1CIM6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
D4N3H6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QVK6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QVT4_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E1AI10_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
H0PPE7_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A3G8WIY5_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
Q9YL99_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
K7ZLN6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A384ZUF2_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A384ZUM9_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
E1CIR1_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UHQ8_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1ULP4_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
A0A291B0H2_E1B19K-      ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
W8VNG2_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
F8UFP5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QV87_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QU02_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UKV6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QV47_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLA--
M0QUW8_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLA--
E1CIJ0_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLA--
T1UGU0_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLA--
M0QVG6_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
X4YVU5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QUS9_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
G1FBW4_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGSPLS--
M0QVP5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UKQ0_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGSPLS--
W8CZB0_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
G1FC01_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
G3CK71_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UGT5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UK99_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QTS5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
M0QV08_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
G9JUV5_E1B19K-01        ----------------------KTRRLVEDSSDGCSGFWRHWFGTPLS--
T1UGX3_E1B19K-01        ----------------------QTRRLVEDSSDGCSGFWRHWFGTPLS--
Q7T951_E1B19K-01        ----------------------KTRQLLESASDGVSGFWRFWFASELA--
T1UE63_E1B19K-01        ----------------------KTRQLLESASDGVSGFWRFWFASELA--
Q7T8D8_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
Q8B8U7_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
Q5UW22_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
W6EIX6_E1B19K-01        ----------------------KTRQLLEDASDGVSGFWRFWFASELA--
Q3ZL02_E1B19K-01        ----------------------KTRQLLEDASDGVSGFWRFWFASELA--
A0A1L7NRH1_E1B19K-      ----------------------KTRQLLEDASDGVSGFWRFWFASELA--
T1UFS4_E1B19K-01        ----------------------KTRQLLEDASDGVSGFWRFWFASELA--
Q32UI6_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
A0A7G5F9T0_E1B19K-      ----------------------KTRQLLENASDGVSGFWRFWFASELA--
C7SRS7_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASEIA--
J7H4R9_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
D2DM83_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
A0A7U3S1T6_E1B19K-      ----------------------KTRQLLENASDGVSGFWRFWFASEIA--
A0A7U3S224_E1B19K-      ----------------------KTRQLLENASDGVSGFWRFWFASELA--
J7I6W7_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
T1UJX4_E1B19K-01        ----------------------KTRQLLENASDGVSGFWRFWFASELA--
A0A7G5FB98_E1B19K-      ----------------------KTRQLLESASDGVSGFWRFWFASELA--
T2CI10_E1B19K-01        ----------------------QTRQLLENASDGVSGLWRFWFGGDLA--
A0A0K0PX99_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A0K0PX35_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
J7ID56_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A0B4SJH1_E1B19K-      ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
A0A075IQ70_E1B19K-      ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
Q2KS85_E1B19K-01        ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
Q3ZKW2_E1B19K-01        ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
K7NG43_E1B19K-01        ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
Q2KRU2_E1B19K-01        ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
A0A8B0LCV0_E1B19K-      ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
T1UIP3_E1B19K-01        ----------------------QTRLLLENASDGVSGFWRFWFGGDLA--
A0A8B0L9Y2_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A6M6AA96_E1B19K-      ----------------------QTRLLIENASDGVSGLWRFWFGGDLA--
A0A220VZ73_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFCFGGDLA--
A0A8B0LD36_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A8B0LBX6_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
R4HLE1_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
R4HMC6_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A897JQR0_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
I1V161_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
P03248_E1B19K-02        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
Q6RK98_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
A0A5P8KYF0_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
J7I6Q4_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
J7I6S4_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
R4HLJ6_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
R4HLA0_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
Q2KSL3_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
Q2Y0J3_E1B19K-01        ----------------------QTKLLLENASDGVSGLWRFWFGGDLA--
A0A5J6CTQ0_E1B19K-      ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
Q5EY83_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
I6LEP5_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
I6LES1_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
T1UF50_E1B19K-01        ----------------------QTRLLLENASDGVSGLWRFWFGGDLA--
Q6QPF3_E1B19K-01        ----------------------QTRQLLENSSEGVSYLWRFCFGGPLA--
Q6QPB7_E1B19K-01        ----------------------QTRQLLENSSEGVSYLWRFCFGGPLA--
Q6QPI9_E1B19K-01        ----------------------QTRQLLENSSEGVSYLWRFCFGGPLA--
P10406_E1B19K-01        ----------------------KTRQLLENASNGVSHLWRFCFGGDLA--
Q5GFC7_E1B19K-02        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A2R3WN62_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A3G9JTX5_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q2KSM8_E1B19K-02        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A2R3WNP3_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q2KSG6_E1B19K-02        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A2L1F392_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A3G9CMQ4_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q5GFC7_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q5GFC8_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q6H1D7_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A3G8W6L2_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A3G9K5X3_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q2KSG6_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
Q2KSM8_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
A0A2R3WN16_E1B19K-      ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
G9G841_E1B19K-01        ----------------------KTRQLLENASNGVSHLWRFCFGGDLA--
Q8UY91_E1B19K-01        ----------------------KTRQLLENASNGVSYLWRFCFGGDLA--
D3JIR7_E1B19K-01        ----------------------GVRQLLQYTSKNTSGFWRYLFGSTLC--
A0A076V686_E1B19K-      ----------------------SIRQLLQHTSRNTSGFWRYLFGSTLS--
A0A5H2QAX5_E1B19K-      ----------------------SVRQLLQYTSKNTSGFWRYLFGSTLS--
G1DE13_E1B19K-01        ----------------------SVRQLLQYTSKNTSGFWRYLFGSTFS--
D0Z5R9_E1B19K-01        ----------------------SVRQLLQYTSKNTSGFWRYLFGSTLS--
T1UEX7_E1B19K-01        ----------------------SVRQLLQYTSKNTSGFWRYLFGSTLS--
A0A3G8WH01_E1B19K-      ----------------------SVRQLLQYTSKNTSGFWRYLFGSTLS--
P04492_E1B19K-01        ----------------------SVRQLLQYTSKNTSGFWRYLFGSTLS--
A0A2H5AI99_E1B19K-      ----------------------VVRQLLESASDKTSKFWRFCFGSTLS--
A0A0M3TH31_E1B19K-      ----------------------VLRKLLETACEKTSSCWRFFFGSTLS--
M9YXY5_E1B19K-01        ----------------------VLRKLLETACEKTSSCWRFFFGSTLS--
M9YVF6_E1B19K-01        ----------------------VLRKLLETACEKNRSCWRFFFGSTLS--
A0MK43_E1B19K-01        ----------------------VVRRLLELASDKTSRLWRFWFGSTLS--
A0A2H5AI21_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A0M5L3Y4_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
Q5C8R2_E1B19K-01        ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A0A1EUB2_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A0A1EUC8_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A2H5AI04_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A2H5AI72_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A2H5AIL3_E1B19K-      ----------------------VVRRLLELASDRTSKFWRFCFGSTLS--
A0A2H4CJZ0_E1B19K-      ----------------------SLRHLLELASARTSTCWRFCFGSTLS--
H8PFZ1_E1B19K-01        ----------------------SLRRLLELASARTSTCWRFCFGSTLS--
A0A7U3RVU4_E1B19K-      ----------------------NLRRLLELASARTSSCWRILFGSTLA--
A0A142G3J2_E1B19K-      ----------------------NLRRLLELASARTSSCWRILFGSTLA--
P10543_E1B19K-01        ----------------------NLRRLLELASARTSSCWRILFGSTLT--
A0A6M6AEV2_E1B19K-      ----------------------NLRRLLELASARTSSCWRILFGSTLT--
A0A7U3RWV6_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A1S6ELT2_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A3G4W995_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A898KBW7_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A482EVC6_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
B5SNR1_E1B19K-01        ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
P10544_E1B19K-01        ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
W0S1G8_E1B19K-01        ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A3G8W407_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A898KBS1_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
F4ZCJ8_E1B19K-01        ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A898KBR0_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A6B9DS29_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A6M6AES6_E1B19K-      ----------------------SLRRLLELASARTSSCWRFIFGSTLT--
A0A7L4WGT1_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SP19_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A291P1B2_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A5K6WAR5_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
T1UG63_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A1U9ALK7_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A6M5E4Y6_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
P03247_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3G8W3H5_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
E1U5L6_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A516UYI9_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
J9Z5H0_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SND6_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
J9Z4N4_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3Q9HJZ5_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A513TZR1_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A516UYM9_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7L4WG90_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
J9Z4H6_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A6M4W5T4_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7L4WIG2_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
J7I6T8_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7L4WK62_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SNH4_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
Q6WQ37_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7D0TN91_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRVLWGSSQA--
Q6VGV8_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A0G2R248_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3Q9HJ54_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SSS2_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3S9SNY0_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSCQA--
A0A2H4PJ75_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7D6TSN5_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
Q71BY5_E1B19K-04        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A4P2SGW2_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3Q9HJ63_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7L4WIC2_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A7L4WJT1_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
A0A3Q9HLF7_E1B19K-      ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
E1ARN8_E1B19K-01        ----------------------AVRNLLEQSSNSTSWFWRFLWGSSQA--
P06501_E1B19K-01        ----------------------STRRLLELCSNRTSFLWRWLFGTPLS--
A0A0M4N3Z1_E1B19K-      ----------------------STRRLLELCSNRTSFLWRWLFGTPLS--
Q8B6X5_E1B19K-01        ----------------------STRRLLELCSNRTSFLWRWLFGTPLS--
H9AAD9_E1B19K-01        ----------------------STRRLVELCSNRSSWFGRFLFGSTLC--
H9AAH3_E1B19K-01        ----------------------STRRLVELCSNRSSWFGRFLFGSTLC--
H9AAA8_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
M9YVA3_E1B19K-01        ----------------------STRCLLELCSNRDPWWKRLLFGTSLC--
F2WTJ7_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
F2WTM9_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
H9AA76_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
A0A1C8EG46_E1B19K-      ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
H9AAN8_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
H9AAS0_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
H9AAV3_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
H9AAY5_E1B19K-01        ----------------------STRCLLELCSNRASWWKRLLFGTSLC--
A0A1L3INW0_E1B19K-      ----------------------TLRQLLEEASNSTSYCWRFLFGSPLG--
F6KST6_E1B19K-01        ----------------------SLRRLLEEASDRTSYFWRFLCGSPLS--
F2WTG5_E1B19K-01        ----------------------SLRRLLEEASDRTSYIWRFLFGSPLS--
Q695T5_E1B19K-01        ----------------------SLRRLLEEASDRTSYIWRFLFGSPLS--
H9TER0_E1B19K-01        ----------------------SLRRLLEEASDRTSYIWRFLFGSPLS--
Q5EY83_E1B19K-03        ---------------------------MLEPDAFSRVSVTGIFDMNI---
E1U5L6_E1B19K-04        ---------------------------MERRNPSERGVPAGFSGHASVES
E1ARN8_E1B19K-04        ---------------------------MERRNPSERGVPAGFSGHAFVES
Q5GFC7_E1B19K-05        ---------------------------MESRNPFQQGLPAGFLSSSFVEN
Q2KSG6_E1B19K-05        ---------------------------MESRNPFQQGLPVGFLSSSFVES
Q2KSM8_E1B19K-05        ---------------------------MESRNPFQQGLPVGFLSSSFVES
                                                                          

Q71BY5_E1B19K-03        ----------HIICHGGV----------ITEEMAASLLDQ----------
Q71BY5_E1B19K-01        ----------RECNSSTD---------SCDSGPSN-TPPEIH--------
Q71BY5_E1B19K-02        ----------RECNSSTD---------SCDSGPSN-TPPEIH--------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        ----------NMVCGVSD--QSARRYVTCADGNCH-ALKTIHVVSHVKHR
A0A5H2QAX5_E1B19K-      ----------NMVCGVSD--QTMRRFVTCADGNCH-TLKTVHIVSHARYC
T1UEX7_E1B19K-02        ----------NMVCGVSD--QTMRRFVTCADGNCH-TLKTVHIVSHARYC
M0QU02_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHITSHARKK
Q695T5_E1B19K-02        ----------NMICGPGDVPPKPYQMVTCTDGKVR-MLKPVHIVGHRRHR
P04492_E1B19K-02        ----------NMVCGVSD--QTMRRFVTCADGNCH-TLKTVHIVSHSRHC
A0MK43_E1B19K-02        ----------NMICG-SG--LCPSQLLTCADGNCH-TLRTVHIVSHSRRT
A0A482EVC6_E1B19K-      ----------NMICG-TG----HSQLLTCADGNCQ-TLKVIHVVSHQRRP
A0A7D0TLU2_E1B19K-      ----------NMVCGNCE--ALSSQLPTTMLCINH-SLKIIHVASHSRKA
Q6VGV8_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
A0A0G2R248_E1B19K-      ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
A0A4P2SGW2_E1B19K-      ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
E1ARN8_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
E1U5L6_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
J9Z5H0_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
J9Z4N4_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
T1UG63_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
J7I6T8_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
J9Z4H6_E1B19K-02        ----------NMVCGNCE--DRASQMLTCSDGNCH-LLKTIHVASHSRKA
T1UGY3_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A1P7YWR9_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A1P7YWY2_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A1P7YXN8_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A1P8C849_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UG22_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A1P7YYY5_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNMHVTSHPRKK
M0QUW8_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
M0QVP5_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
M0QUS9_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
T1UKQ0_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
M0QV47_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
T1UGU0_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
G1FBW4_E1B19K-02        ----------NVIKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKR
F1DT57_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
E9P585_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCY-ILKNIHVTAHPRKK
T1UKP8_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTAHSRKK
W8CZB0_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTAHSRKK
T1ULJ8_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCY-ILKNIHVTAHSRKK
M0QUB4_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTAHSRKK
M0QVT4_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTAHSRKK
M0QVG6_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHARKK
T1UK99_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTAHSRKK
C5HDR2_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A3S6PYX7_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A097I4T0_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QV87_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHSRKK
T1UKV6_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
F8UFP5_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UGT5_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A384ZUM9_E1B19K-      ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHARKK
M0QUJ3_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UHQ8_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UHH6_E1B19K-02        ----------NVVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UHL7_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A075TSZ1_E1B19K-      ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QVK6_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1ULP4_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
C4P207_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QUN2_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
E1AI10_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A384ZUF2_E1B19K-      ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UHG3_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QTS5_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QV08_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QU76_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QU41_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QVC7_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A3Q9FFS0_E1B19K-      ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UGX3_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
T1UHZ2_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
A0A0G2UY10_E1B19K-      ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
M0QUF3_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
G1FC01_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
G3CK71_E1B19K-02        ----------NMVKGCTD--ERMYNMLTCDSGVCH-ILKNIHVTSHPRKK
I6LEP5_E1B19K-03        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
I6LES1_E1B19K-03        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
T2CI10_E1B19K-02        ----------NMICGPSD--ERPYQMLTCAGGHCN-MLATVHIVSHPRKK
Q5GFC7_E1B19K-03        ----------NMICGASD--ERGYQMLTCAGGNSH-MLAAVHVASHSRKP
Q6H1D7_E1B19K-02        ----------NMICGASD--ERGYQMLTCAGGNSH-MLAAVHVASHSRKP
R4HLE1_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
R4HLA0_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
J7ID56_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q5EY83_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
K7NG43_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
A0A0B4SJH1_E1B19K-      ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
A0A075IQ70_E1B19K-      ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
T1UIP3_E1B19K-02        ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q2KRU2_E1B19K-02        ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q2KS85_E1B19K-02        ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q3ZKW2_E1B19K-02        ----------NMICGHSN--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
R4HLJ6_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
R4HMC6_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
A0A897JQR0_E1B19K-      ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q2KSL3_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q2Y0J3_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
I1V161_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
Q6RK98_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
A0A5P8KYF0_E1B19K-      ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
I6LEP5_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
I6LES1_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
J7I6Q4_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
J7I6S4_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
T1UF50_E1B19K-02        ----------NMICGHSD--ERPYQMLTCAGGHCN-ILATVHIVSHARKK
T1UJX4_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
A0A7G5FB98_E1B19K-      ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
Q32UI6_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
J7I6W7_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
Q7T8D8_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
Q3ZL02_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
T1UFS4_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
W6EIX6_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
T1UE63_E1B19K-02        ----------NMICGASD--ERPYQMLTCAGGHCN-MLATVHIVSHQRKK
Q2KSG6_E1B19K-03        ----------NMICGASD--ERGYQMLTCAGGNSH-MLATVHVASHPRKP
Q2KSM8_E1B19K-03        ----------NMICGASD--ERGYQMLTCAGGNSH-MLATVHVASHPRKP
Q7T8D8_E1B19K-03        ------------------------SWAGVRQNVMG---STVDGRPVQ---
Q6RK98_E1B19K-03        ------------------------PWAGVRQNVMG---STVDGRPVQ---
A0A0M4NHE0_E1B19K-      ----------RVVRQVKE--EYQSEFEHILSNCPG-LFVSLDLGHHT---
H9AAK5_E1B19K-01        ----------RVVRQVKE--EYQSEFEHILSNCPG-LFVSLDLGHHT---
G0ZAH2_E1B19K-01        ----------RTVAQVKT--DYSEHFEQLLQEQNRLLLNNLELGHTR---
A0A3Q9HK00_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3Q9HK78_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SPV1_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
Q2KSM8_E1B19K-04        MEVPAPECNLRLLAGTAA--RHSEDPKSPANFPGT-PTPPAAAGGSR---
Q2KSG6_E1B19K-04        MEVPAPECNLRLLAGTAA--RHSEDPKSPANFPGT-PTPPAAAGGSR---
Q5GFC7_E1B19K-04        MEVPAPECNLRLLAGTAA--RHSEDPESP------------AAGGSR---
E1U5L6_E1B19K-03        GGETQESPATVVFRPPGN--NTDGG-----ATAGG-SQAAAAAGAEP---
E1ARN8_E1B19K-03        GGETQESPTTVVFRPPGN--NTDGGAAAATAAAGG-SQAAAAAGAEP---
A0A1W5PVU4_E1B19K-      ----------QLVVQAKV--EYKEEFEKLFSEVPG-LVDSLNFCHHA---
A0A0M3TH18_E1B19K-      ----------QLVVQAKV--EYKEEFEKLFSEVPG-LVDSLNFCHHA---
A0A097IW62_E1B19K-      ----------CLVVQAKF--EYREEFERLFAEVPG-LLESLNFCHHA---
A0A0A1EUE4_E1B19K-      ----------SVVYRVKK--EQEGQFSRLLADIPG-VFVALDLGHHS---
A0A2H5AI40_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AID8_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AII9_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIL0_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIN5_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIS9_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIT6_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIU0_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A2H5AIC5_E1B19K-      ----------SVVYRVKR--EQEAQFARLLAETPG-VLVALDLGHHS---
A0A0G2UY10_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
X4Y9D2_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
C5HDR2_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
M0QVC7_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A3S6PYX7_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
Q4KSL0_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A1P7YYY5_E1B19K-      ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
A0A1P8C849_E1B19K-      ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
B9A5L5_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
T1UGY3_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
A0A1P7YWR9_E1B19K-      ----------RLVYTVKK--DYSEEFENIFADCSG-LLDSLNFGHQS---
A0A1P7YWY2_E1B19K-      ----------RLVYTVKK--DYSEEFENIFADCSC-LLDSLNFGHQS---
A0A1P7YXN8_E1B19K-      ----------RLVYTVKK--DYSEEFENIFADCSC-LLDSLNFGHQS---
B9A5A7_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
T1UG22_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFADCSG-LLDSLNFGHQS---
H5T740_E1B19K-01        ----------RLVYTVKK--DYQDEFENLFADCSG-LLDSLNLGHQA---
A0A1J0MS84_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A097I4T0_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
E5RWD9_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
M0QU76_E1B19K-01        ----------RLVYTVKK--DYNEEIENLFADCSG-LLDSLNLGHQS---
B9A5T7_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A7R6T9I9_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
D3GBW3_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
M0QUF3_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
E5RWL1_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
B6C6W8_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
M0QU41_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
F1DT57_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
B2VQE3_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
B9A681_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A1Y1BYF1_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
B6DU90_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
T1UHZ2_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A3Q9FFS0_E1B19K-      ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
T1ULJ8_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQA---
T1UHG3_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
E9P585_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
A0A1Y1BXT7_E1B19K-      ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
T1UHL7_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
A0A075TSZ1_E1B19K-      ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
T1UHH6_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
T1UKP8_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
B9A5Q1_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
M0QUB4_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
M0QUJ3_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
M0QUN2_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
C4P207_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
E1CIM6_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
D4N3H6_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
M0QVK6_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
M0QVT4_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
E1AI10_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
H0PPE7_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
A0A3G8WIY5_E1B19K-      ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
Q9YL99_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
K7ZLN6_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
A0A384ZUF2_E1B19K-      ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
A0A384ZUM9_E1B19K-      ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
E1CIR1_E1B19K-01        ----------RLVYTVKK--DYKEEFENIFADCSG-LLDSLNLGHQS---
T1UHQ8_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNLGHQS---
T1ULP4_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQS---
A0A291B0H2_E1B19K-      ----------RLVYTVKK--DYSEEFENLFSDCSG-LLDSLNLGHQS---
W8VNG2_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFSDCSG-LLDSLNFGHQS---
F8UFP5_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFSDCSG-LLDSLNFGHQS---
M0QV87_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFSDCSG-LLDSLNFGHQS---
M0QU02_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNFGHQS---
T1UKV6_E1B19K-01        ----------RLVYTVKK--DYSEEFENLFSDCSG-LLDSLNFGHQS---
M0QV47_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
M0QUW8_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
E1CIJ0_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
T1UGU0_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
M0QVG6_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFVDCSG-LLDSLNLGHQA---
X4YVU5_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFVDCSG-LLDSLNLGHQA---
M0QUS9_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNLGHQA---
G1FBW4_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
M0QVP5_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
T1UKQ0_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNLGHQA---
W8CZB0_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
G1FC01_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
G3CK71_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
T1UGT5_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
T1UK99_E1B19K-01        ----------RLVYTVKK--DYQEEFENLFADCSG-LLDSLNFGHQS---
M0QTS5_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
M0QV08_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
G9JUV5_E1B19K-01        ----------RLVYTVKK--DYNEEFENLFADCSG-LLDSLNFGHQS---
T1UGX3_E1B19K-01        ----------RLVYTVKK--DYKEEFENLFADCSG-LLDSLNFGHQS---
Q7T951_E1B19K-01        ----------RVVFRIKQ--DYKQEFEKLLVDCPG-LFEALNLGHQV---
T1UE63_E1B19K-01        ----------RVVFRIKQ--DYKQEFEKLLVDCPG-LFEALNLGHQV---
Q7T8D8_E1B19K-01        ----------RVVFRIKQ--DYKQEFEKLLVDCPG-LFEALNLGHQV---
Q8B8U7_E1B19K-01        ----------RVVFRIKQ--DYNQEFEKLLVDCPG-LFEALNLGHQV---
Q5UW22_E1B19K-01        ----------RVVFRIKQ--DYKQEFEKLLVDCPG-LFEALNLGHQV---
W6EIX6_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLLDCPG-LFEALNLGHQV---
Q3ZL02_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
A0A1L7NRH1_E1B19K-      ----------RVVFRIKQ--DYKEEFEKLLLDCPG-LFEALNLGHQV---
T1UFS4_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
Q32UI6_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
A0A7G5F9T0_E1B19K-      ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
C7SRS7_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
J7H4R9_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
D2DM83_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
A0A7U3S1T6_E1B19K-      ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
A0A7U3S224_E1B19K-      ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
J7I6W7_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
T1UJX4_E1B19K-01        ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
A0A7G5FB98_E1B19K-      ----------RVVFRIKQ--DYKEEFEKLLVDCPG-LFEALNLGHQV---
T2CI10_E1B19K-01        ----------RLVFRIKQ--DYRQEFEKLLDDCPG-LFEALNLGHQA---
A0A0K0PX99_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A0K0PX35_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
J7ID56_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A0B4SJH1_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A075IQ70_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q2KS85_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q3ZKW2_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
K7NG43_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q2KRU2_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A8B0LCV0_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
T1UIP3_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A8B0L9Y2_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A6M6AA96_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A220VZ73_E1B19K-      ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
A0A8B0LD36_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A8B0LBX6_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
R4HLE1_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDNSPG-LFEALNLGHQA---
R4HMC6_E1B19K-01        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
A0A897JQR0_E1B19K-      ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
I1V161_E1B19K-01        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
P03248_E1B19K-02        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
Q6RK98_E1B19K-01        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
A0A5P8KYF0_E1B19K-      ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
J7I6Q4_E1B19K-01        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
J7I6S4_E1B19K-01        ----------RLVFRIKQ--DYSVEFEKLLDDSPG-LFEALNLGHQA---
R4HLJ6_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
R4HLA0_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q2KSL3_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q2Y0J3_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
A0A5J6CTQ0_E1B19K-      ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q5EY83_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDIPG-LFEALNLGHQA---
I6LEP5_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHRA---
I6LES1_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
T1UF50_E1B19K-01        ----------RLVFRIKQ--DYREEFEKLLDDSPG-LFEALNLGHQA---
Q6QPF3_E1B19K-01        ----------KLVYRAKQ--DYKEQFEDILRECPG-IFDSLNLGHQS---
Q6QPB7_E1B19K-01        ----------KLVYRAKQ--DYKDQFEDILRECPG-IFDSLNLGHQS---
Q6QPI9_E1B19K-01        ----------KLVYRAKQ--DYKDQFEDILRECPG-IFDSLNLGHQS---
P10406_E1B19K-01        ----------KLVYRAKQ--DYREQFEDILRECPS-LFDALNLGHQS---
Q5GFC7_E1B19K-02        ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
A0A2R3WN62_E1B19K-      ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
A0A3G9JTX5_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
Q2KSM8_E1B19K-02        ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
A0A2R3WNP3_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
Q2KSG6_E1B19K-02        ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
A0A2L1F392_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
A0A3G9CMQ4_E1B19K-      ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
Q5GFC7_E1B19K-01        ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
Q5GFC8_E1B19K-01        ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
Q6H1D7_E1B19K-01        ----------KLVYRAKQ--DYREQFEDILRECPG-LFDALNLGHQS---
A0A3G8W6L2_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
A0A3G9K5X3_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
Q2KSG6_E1B19K-01        ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
Q2KSM8_E1B19K-01        ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
A0A2R3WN16_E1B19K-      ----------KLVYRTKQ--DYKEQFDDILKECPG-LFDALNLGHQS---
G9G841_E1B19K-01        ----------KLVYRAKQ--DYSEQFEVILRECPG-LFDALNLGHQT---
Q8UY91_E1B19K-01        ----------RLVYRAKQ--DYSEQFEVILRECSG-LFDALNLGHQS---
D3JIR7_E1B19K-01        ----------KVVHRVKE--DYRKEFENILAGCPG-LLASLDLCHHS---
A0A076V686_E1B19K-      ----------KVVHRVKE--DYRNEFENILAGCPG-LLASLDLCHHS---
A0A5H2QAX5_E1B19K-      ----------KVVHRVKE--DYREEFENILADCPG-LLASLDLCHHS---
G1DE13_E1B19K-01        ----------KVVHRVKE--DYREEFENILTDCPG-LLASLDLCHHS---
D0Z5R9_E1B19K-01        ----------KVVHRVKE--DYREEFENILADCPG-LLASLDLCHHS---
T1UEX7_E1B19K-01        ----------KVVHRVKE--DYREEFENILADCPG-LLASLDLCHHS---
A0A3G8WH01_E1B19K-      ----------KVVNRVKE--DYREEFENILADCPG-LLASLDLCHHL---
P04492_E1B19K-01        ----------KVVNRVKE--DYREEFENILADCPG-LLASLDLCYHL---
A0A2H5AI99_E1B19K-      ----------NVVYRVKK--EQAEQFSRLLAEIPG-VFVALDLGHHA---
A0A0M3TH31_E1B19K-      ----------NVVHRVKR--EHSEEFSRLVADVPG-LFVSLDLGHHS---
M9YXY5_E1B19K-01        ----------NVVHRVKR--EHSEEFSRLVADVPG-LFVSLDLGHHS---
M9YVF6_E1B19K-01        ----------NVVHRVKR--EHSEEFSRLVADVPG-LFVSLDLGHHS---
A0MK43_E1B19K-01        ----------SVVYRVKR--EQEAQFARLLADTPG-VFVALDLGHHS---
A0A2H5AI21_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A0M5L3Y4_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
Q5C8R2_E1B19K-01        ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A0A1EUB2_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A0A1EUC8_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A2H5AI04_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A2H5AI72_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A2H5AIL3_E1B19K-      ----------NVLYRVKK--EQETQFARLLADTPG-VFVALDLGHHS---
A0A2H4CJZ0_E1B19K-      ----------NVVYRVKQ--EYSSRFSELLARYPA-VFASLDLGHHV---
H8PFZ1_E1B19K-01        ----------NVVYRVKQ--EYSSRFSELLARYPA-VFVSLDLGHHV---
A0A7U3RVU4_E1B19K-      ----------NVIYRAKE--EYSSRFADLLSHNPG-IFASLNLGHHS---
A0A142G3J2_E1B19K-      ----------NVIYRAKE--EYSSRFADLLSHNPG-IFASLNLGHHS---
P10543_E1B19K-01        ----------NVIYRAKE--EYSSRFADLLSHNPG-IFASLNLGHHS---
A0A6M6AEV2_E1B19K-      ----------NVIYRAKE--EYSSRFADLLSHNPG-IFASLNLGHHS---
A0A7U3RWV6_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A1S6ELT2_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A3G4W995_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A898KBW7_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A482EVC6_E1B19K-      ----------NVIYRAKE--DYSSQFAELLSFNPG-IFASLNLGHHS---
B5SNR1_E1B19K-01        ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
P10544_E1B19K-01        ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
W0S1G8_E1B19K-01        ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A3G8W407_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A898KBS1_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
F4ZCJ8_E1B19K-01        ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A898KBR0_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A6B9DS29_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A6M6AES6_E1B19K-      ----------NVIYRAKE--DYSSRFAELLSFNPG-IFASLNLGHHS---
A0A7L4WGT1_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SP19_E1B19K-      ----------KLVCRIKE--DYKWEFEDLLKSCGE-LFDSLNLGHQA---
A0A291P1B2_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A5K6WAR5_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
T1UG63_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A1U9ALK7_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A6M5E4Y6_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
P03247_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3G8W3H5_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
E1U5L6_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A516UYI9_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
J9Z5H0_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SND6_E1B19K-      ----------KLVCRVKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
J9Z4N4_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3Q9HJZ5_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A513TZR1_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A516UYM9_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7L4WG90_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
J9Z4H6_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A6M4W5T4_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7L4WIG2_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
J7I6T8_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7L4WK62_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SNH4_E1B19K-      ----------KLVCRVKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
Q6WQ37_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7D0TN91_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
Q6VGV8_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A0G2R248_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3Q9HJ54_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SSS2_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3S9SNY0_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A2H4PJ75_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7D6TSN5_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
Q71BY5_E1B19K-04        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A4P2SGW2_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3Q9HJ63_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7L4WIC2_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A7L4WJT1_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
A0A3Q9HLF7_E1B19K-      ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
E1ARN8_E1B19K-01        ----------KLVCRIKE--DYKWEFEELLKSCGE-LFDSLNLGHQA---
P06501_E1B19K-01        ----------RLVRQVKL--EYEKDFERILDQCPG-VFESLELGYHK---
A0A0M4N3Z1_E1B19K-      ----------RLVRQVKL--EYEKDFERILDQCPG-VFESLELGYHK---
Q8B6X5_E1B19K-01        ----------RLVRQVKL--EYEKDFERILDQCPG-VFESLELGYHK---
H9AAD9_E1B19K-01        ----------RVVRQVKE--EYQSEFEHILSNCPG-LFVSLDLGHHT---
H9AAH3_E1B19K-01        ----------RVVRQVKE--EYQSEFEHILSNCPG-LFVSLDLGHHT---
H9AAA8_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
M9YVA3_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
F2WTJ7_E1B19K-01        ----------RLVRQVKE--EYESEFEHILSTCQG-LFESLELGHHT---
F2WTM9_E1B19K-01        ----------RLVRQVKE--EYESEFEHILSTCQG-LFESLELGHHT---
H9AA76_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
A0A1C8EG46_E1B19K-      ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
H9AAN8_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
H9AAS0_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
H9AAV3_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
H9AAY5_E1B19K-01        ----------RLVRQVKE--EYQSEFEHILSTCQG-LFESLELGHHT---
A0A1L3INW0_E1B19K-      ----------RFLYRVKK--DHQEEFDQLIGLFPT-IFESLNLGHKT---
F6KST6_E1B19K-01        ----------RFLNRVKR--EHRAEFDELLEHLPG-LFDSLNLGHRV---
F2WTG5_E1B19K-01        ----------RFLYRVKR--EHLTEFDGLLEQLPG-LFDSLNLGHRT---
Q695T5_E1B19K-01        ----------RFLYRVKR--EHLTEFDGLLEQLPG-LFDSLNLGHRT---
H9TER0_E1B19K-01        ----------RFLHRVKR--EHLTEFDGLLEQLPG-LFDSLNLGHRT---
Q5EY83_E1B19K-03        -----------QLWKILR--YDDTKPRVRACECGG-KHARFQPVCVD---
E1U5L6_E1B19K-04        GGETQESPATVVFRPPGN--NTDGG-----ATAGG-SQAAAAAGAEP---
E1ARN8_E1B19K-04        GGETQESPTTVVFRPPGN--NTDGGAAAATAAAGG-SQAAAAAGAEP---
Q5GFC7_E1B19K-05        MEVPAPECNLRLLAGTAA--RHSEDPESP------------AAGGSR---
Q2KSG6_E1B19K-05        MEVPAPECNLRLLAGTAA--RHSEDPKSPANFPGT-PTPPAAAGGSR---
Q2KSM8_E1B19K-05        MEVPAPECNLRLLAGTAA--RHSEDPKSPANFPGT-PTPPAAAGGSR---
                                                                          

Q71BY5_E1B19K-03        --LIEEVLCLNLSLSPSQNR------------------------------
Q71BY5_E1B19K-01        -PVVPLCPIKPVAVRVGGRR------------------------------
Q71BY5_E1B19K-02        -PVVPLCPIKPVAVRVGGRR------------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        WPVCDHNMFMRCSMHLGLRRGMFVPFQCNLSHTNVLLEPEVFSRISLNGV
A0A5H2QAX5_E1B19K-      WPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVLLEPEAFSRVSLNGV
T1UEX7_E1B19K-02        WPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVMLEPEAFSRVSLNGV
M0QU02_E1B19K-02        WPVFENNMLIKCHVHLGVRRGTFQPYQCNFSQTKLLLESDAFSRVNLNGI
Q695T5_E1B19K-02        WPEFEHNVMTRCSLYLGGRRGVFMPRQCNLAHCNVIMEQSAATQVCFGGI
P04492_E1B19K-02        WPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSNIMLEPEVFSRVCLNGV
A0MK43_E1B19K-02        WPTFEHNMLMRCAVHLGARRGVFMPYQCNFSHTKILLETDSFPRVCFNGV
A0A482EVC6_E1B19K-      WPVFEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETDAFSRVWWSGV
A0A7D0TLU2_E1B19K-      WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPMVMSKVNLNGV
Q6VGV8_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
A0A0G2R248_E1B19K-      WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
A0A4P2SGW2_E1B19K-      WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
E1ARN8_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
E1U5L6_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
J9Z5H0_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
J9Z4N4_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
T1UG63_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
J7I6T8_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
J9Z4H6_E1B19K-02        WPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGV
T1UGY3_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A1P7YWR9_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A1P7YWY2_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A1P7YXN8_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A1P8C849_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UG22_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A1P7YYY5_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUW8_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QVP5_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUS9_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UKQ0_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QV47_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UGU0_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
G1FBW4_E1B19K-02        WPSFENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
F1DT57_E1B19K-02        WPVFENNMLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
E9P585_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UKP8_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
W8CZB0_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1ULJ8_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUB4_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QVT4_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QVG6_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UK99_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
C5HDR2_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A3S6PYX7_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A097I4T0_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QV87_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UKV6_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
F8UFP5_E1B19K-02        WPVFENNLLIKCHMHLGVRRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UGT5_E1B19K-02        WPLFENNLLIKCHVHLGARRGTFQPYQCNLSQTKLLLENDAFSRVNLNGI
A0A384ZUM9_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUJ3_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UHQ8_E1B19K-02        WPVFENNMLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UHH6_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UHL7_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A075TSZ1_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QVK6_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1ULP4_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
C4P207_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUN2_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
E1AI10_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A384ZUF2_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UHG3_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QTS5_E1B19K-02        WPVFENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QV08_E1B19K-02        WPVFENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QU76_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QU41_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QVC7_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A3Q9FFS0_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UGX3_E1B19K-02        WPVFENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
T1UHZ2_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
A0A0G2UY10_E1B19K-      WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
M0QUF3_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
G1FC01_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
G3CK71_E1B19K-02        WPVFENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGI
I6LEP5_E1B19K-03        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
I6LES1_E1B19K-03        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
T2CI10_E1B19K-02        WPVLEHNVMTKCTMHVGGRRGMLMPYQCNMNNVKVMLEPDAFSRMSLTGI
Q5GFC7_E1B19K-03        WPEFEHNVMTRCNMHLGARRGMFMPYQCNLNYVKVLLEPDVMSRVSLTGV
Q6H1D7_E1B19K-02        WPEFEHNVMTRCNMHLGARRGMFMPYQCNLNYVKVLLEPDVMSRVSLTGV
R4HLE1_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
R4HLA0_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
J7ID56_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q5EY83_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSVTGI
K7NG43_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
A0A0B4SJH1_E1B19K-      WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
A0A075IQ70_E1B19K-      WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
T1UIP3_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q2KRU2_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q2KS85_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q3ZKW2_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
R4HLJ6_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
R4HMC6_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
A0A897JQR0_E1B19K-      WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q2KSL3_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q2Y0J3_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
I1V161_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
Q6RK98_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
A0A5P8KYF0_E1B19K-      WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
I6LEP5_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
I6LES1_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
J7I6Q4_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
J7I6S4_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
T1UF50_E1B19K-02        WPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGI
T1UJX4_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
A0A7G5FB98_E1B19K-      WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGM
Q32UI6_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGM
J7I6W7_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGM
Q7T8D8_E1B19K-02        WPVFDHNVMTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
Q3ZL02_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
T1UFS4_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
W6EIX6_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
T1UE63_E1B19K-02        WPVFDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGI
Q2KSG6_E1B19K-03        WPEFEHNVMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGV
Q2KSM8_E1B19K-03        WPEFEHNVMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGV
Q7T8D8_E1B19K-03        --PANSSTLTYATLSSSPLD------AAAAAAAASVA-----ANTVLGMG
Q6RK98_E1B19K-03        --PANSSTLTYATLSSSPLD------AAAAAAATA-A-----ANTILGMG
A0A0M4NHE0_E1B19K-      --VFQEKIVKALDFSSPGRA------VAAIAFAAFLLDRWN-AQTQLSPG
H9AAK5_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFLLDRWN-AQTQLSPG
G0ZAH2_E1B19K-01        --ALNG-VLRELDFENTGRV------VAGLAFLAYLLDRWD-ENSVLSPG
A0A3Q9HK00_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3Q9HK78_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SPV1_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
Q2KSM8_E1B19K-04        --REPE--------SRPGPS------GGGGGVADLFPELRR-VLTRVSLT
Q2KSG6_E1B19K-04        --REPE--------SRPGPS-------GGGGVADLFPELRR-VLTRVSLT
Q5GFC7_E1B19K-04        --RESE--------SRPGPS--------GGGVADLFPELHR-VLTRVSLT
E1U5L6_E1B19K-03        --MEPE--------SRPGPS----------GMNVVQPE----SMSKVNLN
E1ARN8_E1B19K-03        --MEPE--------SRPGPS----------GMNVVQPE----SMSKVNLN
A0A1W5PVU4_E1B19K-      --FFYEKVICGLDFCTPGRT------IAALAFCAFILDKWN-KETHLSRG
A0A0M3TH18_E1B19K-      --FFYEKVICGLDFCTPGRT------IAALAFCAFILDKWN-KETHLSKG
A0A097IW62_E1B19K-      --VFYEKIICSLDFCTPGRT------IAALAFCTYILDRWN-KETHLSAG
A0A0A1EUE4_E1B19K-      --LFQEKIVKSLTFSSPGRT------VVSAAFITYILDQWSSSGSHLSWD
A0A2H5AI40_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSNSHLSWE
A0A2H5AID8_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSDSHLSWE
A0A2H5AII9_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSNSHLSWE
A0A2H5AIL0_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSDSHLSWE
A0A2H5AIN5_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSNSHLSWE
A0A2H5AIS9_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSDSHLSWE
A0A2H5AIT6_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSDSHLSWE
A0A2H5AIU0_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFVAYILDQWSNSNSHLSWE
A0A2H5AIC5_E1B19K-      --LFQEKIIRNLTFSSPGRT------VASAAFITYILDQWSNSDSHLSWE
A0A0G2UY10_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
X4Y9D2_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWR-QDTQLSRG
C5HDR2_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
M0QVC7_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
A0A3S6PYX7_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
Q4KSL0_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1P7YYY5_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1P8C849_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
B9A5L5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UGY3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1P7YWR9_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1P7YWY2_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1P7YXN8_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
B9A5A7_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UG22_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
H5T740_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
A0A1J0MS84_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
A0A097I4T0_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
E5RWD9_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVACVVFLVDKWS-QNTQLSRG
M0QU76_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
B9A5T7_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
A0A7R6T9I9_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
D3GBW3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
M0QUF3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
E5RWL1_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
B6C6W8_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
M0QU41_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
F1DT57_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
B2VQE3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
B9A681_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
A0A1Y1BYF1_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
B6DU90_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
T1UHZ2_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
A0A3Q9FFS0_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
T1ULJ8_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UHG3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
E9P585_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A1Y1BXT7_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UHL7_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A075TSZ1_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UHH6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UKP8_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
B9A5Q1_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QUB4_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QUJ3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QUN2_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
C4P207_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
E1CIM6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
D4N3H6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QVK6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QVT4_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
E1AI10_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
H0PPE7_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A3G8WIY5_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
Q9YL99_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
K7ZLN6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A384ZUF2_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A384ZUM9_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
E1CIR1_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UHQ8_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1ULP4_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
A0A291B0H2_E1B19K-      --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
W8VNG2_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
F8UFP5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
M0QV87_E1B19K-01        --LFQERVLHSLDFSTPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QU02_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
T1UKV6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
M0QV47_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
M0QUW8_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
E1CIJ0_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
T1UGU0_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
M0QVG6_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
X4YVU5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
M0QUS9_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QDTQLSRG
G1FBW4_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
M0QVP5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
T1UKQ0_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
W8CZB0_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
G1FC01_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
G3CK71_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
T1UGT5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
T1UK99_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QQTHLTRD
M0QTS5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
M0QV08_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
G9JUV5_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
T1UGX3_E1B19K-01        --LFQERVLHSLDFSSPGRT------TAGVAFVVFLVDKWS-QNTQLSRG
Q7T951_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
T1UE63_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
Q7T8D8_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
Q8B8U7_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
Q5UW22_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
W6EIX6_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
Q3ZL02_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
A0A1L7NRH1_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
T1UFS4_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
Q32UI6_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
A0A7G5F9T0_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
C7SRS7_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
J7H4R9_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
D2DM83_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
A0A7U3S1T6_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
A0A7U3S224_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
J7I6W7_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
T1UJX4_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
A0A7G5FB98_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-PQTHFSRG
T2CI10_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFIFDKWI-PQTHFSKG
A0A0K0PX99_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSRG
A0A0K0PX35_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
J7ID56_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A0B4SJH1_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A075IQ70_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q2KS85_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q3ZKW2_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
K7NG43_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q2KRU2_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A8B0LCV0_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
T1UIP3_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A8B0L9Y2_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A6M6AA96_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A220VZ73_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A8B0LD36_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLIFILDKWI-RQTHFSKG
A0A8B0LBX6_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
R4HLE1_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
R4HMC6_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A897JQR0_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
I1V161_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
P03248_E1B19K-02        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q6RK98_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A5P8KYF0_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
J7I6Q4_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
J7I6S4_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
R4HLJ6_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
R4HLA0_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q2KSL3_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q2Y0J3_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
A0A5J6CTQ0_E1B19K-      --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q5EY83_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
I6LEP5_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
I6LES1_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
T1UF50_E1B19K-01        --HFKEKVLSVLDFSTPGRT------AAAVAFLTFILDKWI-RQTHFSKG
Q6QPF3_E1B19K-01        --HFNQSILRALDFSTPGRT------TAAVAFFAFILDKWS-QETHFSRD
Q6QPB7_E1B19K-01        --HFNQSILRALDFSTPGRT------TAAVAFFAFILDKWS-QETHFSRD
Q6QPI9_E1B19K-01        --HFNQSILRALDFSTPGRT------TAAVAFFAFILDKWS-QETHFSRD
P10406_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
Q5GFC7_E1B19K-02        --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
A0A2R3WN62_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
A0A3G9JTX5_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
Q2KSM8_E1B19K-02        --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
A0A2R3WNP3_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
Q2KSG6_E1B19K-02        --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
A0A2L1F392_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
A0A3G9CMQ4_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
Q5GFC7_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
Q5GFC8_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
Q6H1D7_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFIFDKWS-QETHFSRD
A0A3G8W6L2_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
A0A3G9K5X3_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
Q2KSG6_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
Q2KSM8_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
A0A2R3WN16_E1B19K-      --HFNQRISRALDFTTPGRT------TAAVAFFAFVLDKWS-QETHFSRD
G9G841_E1B19K-01        --HFNQRIVRALDFTTPGRS------TAAVAFFAFLLDKWS-QETHFSRD
Q8UY91_E1B19K-01        --HFNQRISRALDFTTPGRT------TAAVAFFAFILDKWS-QETHFSRD
D3JIR7_E1B19K-01        --IFQEKVVKSLDFSSAGRT------VASIAFLVTVLDKWS-QTSQLSWD
A0A076V686_E1B19K-      --IFQEKVVRSLDFSSAGRT------VASIAFLVTVLDKWS-QASQLSWD
A0A5H2QAX5_E1B19K-      --VFQERVVRSLDFSSSGRT------VASIAFLATVLDKWS-ERSHLSWD
G1DE13_E1B19K-01        --VFQERVVRSLDFSSSGRT------VASIAFLVTVLDKWS-ERSHLSWD
D0Z5R9_E1B19K-01        --VFQERVVRSLDFSSSGRT------VASIAFLATVLDKWS-ERSHLSWD
T1UEX7_E1B19K-01        --VFQERVVRSLDFSSSGRT------VASIAFLATVLDKWS-ERSHLSWD
A0A3G8WH01_E1B19K-      --VFQEKVVRSLDFSSVGRT------VASIAFLATILDKWS-EKSHLSWD
P04492_E1B19K-01        --VFQEKVVRSLDFSSVGRT------VASIAFLATILDKWS-EKSHLSWD
A0A2H5AI99_E1B19K-      --LFQEKVIKSLTFSSPGRV------VTSLAFICHLLDKWS-SDSHLSWN
A0A0M3TH31_E1B19K-      --YFQEKIVKGLVFESTGRT------VVSVAFICFLLDKWS-SDSHLSWD
M9YXY5_E1B19K-01        --YFQEKIVKGLVFESTGRT------VVSVAFICFLLDKWS-SDSHLSWD
M9YVF6_E1B19K-01        --YFQEKIVKGLVFESTGRT------VVSVAFICFLLDKWS-SDSHLSWD
A0MK43_E1B19K-01        --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSDSHLSWE
A0A2H5AI21_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSDSHLSWE
A0A0M5L3Y4_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSDSHLSWE
Q5C8R2_E1B19K-01        --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSDSHLSWE
A0A0A1EUB2_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSGSHLSWE
A0A0A1EUC8_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSGSHLSWE
A0A2H5AI04_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSGSHLSWE
A0A2H5AI72_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSGSHLSWE
A0A2H5AIL3_E1B19K-      --LFQEKIIKNLTFTSPGRT------VASAAFITYILDQWSNSGSHLSWE
A0A2H4CJZ0_E1B19K-      --YFQEAVVRYLDFSTPGRT------VSALAFICFVLDRWS-AQTRLSPG
H8PFZ1_E1B19K-01        --YFQEAVVRYLDFSTPGRA------VSAIAFICFVLDRWS-AQTRLSPG
A0A7U3RVU4_E1B19K-      --FFQEIVIRNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSQG
A0A142G3J2_E1B19K-      --FFQEIVIRNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSQG
P10543_E1B19K-01        --FFQEIVIRNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSQG
A0A6M6AEV2_E1B19K-      --FFQEIVIRNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSQG
A0A7U3RWV6_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGVGLIWCVCIQES-AYTHLSEG
A0A1S6ELT2_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A3G4W995_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A898KBW7_E1B19K-      --FFQEIVIKNLDFSSPGRA------VSGLAFICFILDQWS-AQTHLSEG
A0A482EVC6_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
B5SNR1_E1B19K-01        --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
P10544_E1B19K-01        --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
W0S1G8_E1B19K-01        --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A3G8W407_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A898KBS1_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
F4ZCJ8_E1B19K-01        --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A898KBR0_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A6B9DS29_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A6M6AES6_E1B19K-      --FFQEIVIKNLDFSSPGRT------VSGLAFICFILDQWS-AQTHLSEG
A0A7L4WGT1_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SP19_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A291P1B2_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A5K6WAR5_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
T1UG63_E1B19K-01        --LFQEKVIKTLDFSTPGRT------AAAVAFLSFIKDKWS-EETHLSGG
A0A1U9ALK7_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A6M5E4Y6_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
P03247_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3G8W3H5_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
E1U5L6_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A516UYI9_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
J9Z5H0_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SND6_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
J9Z4N4_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3Q9HJZ5_E1B19K-      --LFQEKVIKTLDFSTPGRV------AAAVAFLSFIKDKWS-EETHLSGG
A0A513TZR1_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A516UYM9_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7L4WG90_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
J9Z4H6_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A6M4W5T4_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7L4WIG2_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
J7I6T8_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7L4WK62_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SNH4_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
Q6WQ37_E1B19K-01        --LLQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7D0TN91_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
Q6VGV8_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A0G2R248_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3Q9HJ54_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SSS2_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3S9SNY0_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A2H4PJ75_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7D6TSN5_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
Q71BY5_E1B19K-04        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A4P2SGW2_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3Q9HJ63_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7L4WIC2_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A7L4WJT1_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
A0A3Q9HLF7_E1B19K-      --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
E1ARN8_E1B19K-01        --LFQEKVIKTLDFSTPGRA------AAAVAFLSFIKDKWS-EETHLSGG
P06501_E1B19K-01        --VFEEKIVKELDFSSPGRA------VAAVAFASYLLDRWN-TRTHLSPG
A0A0M4N3Z1_E1B19K-      --VFEDKIVKELDFSSPGRA------VAAVAFASYLLDRWN-TRTHLSPG
Q8B6X5_E1B19K-01        --VFEDKIVKELDFSSPGRA------VAAVAFASYLLDRWN-TRTHLSPG
H9AAD9_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFLLDRWN-AQTQLSPG
H9AAH3_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFLLDRWN-AQTQLSPG
H9AAA8_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
M9YVA3_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
F2WTJ7_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-SQTQLSPG
F2WTM9_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-SQTQLSPG
H9AA76_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
A0A1C8EG46_E1B19K-      --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
H9AAN8_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
H9AAS0_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
H9AAV3_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
H9AAY5_E1B19K-01        --VFQEKIVKALDFSSPGRA------VAAIAFAAFILDRWN-TQTQLSPG
A0A1L3INW0_E1B19K-      --LLEDKLLVQLDFSTPGRA------CSGLAFVVHLLDRWN-QETYLSPG
F6KST6_E1B19K-01        --LLEERLFPQLDFSSPGRL------CSALAFVVHLLDRWN-EQTQLSPG
F2WTG5_E1B19K-01        --LLEERLFPQLDFSSPGRL------CSALAFAVHLLDRWN-EQTQLSPG
Q695T5_E1B19K-01        --LLEERLFPQLDFSSPGRL------CSALAFAVHLLDRWN-EQTQLSPG
H9TER0_E1B19K-01        --LLEERLFPQLDFSSPGRL------CSALAFAVHLLDRWN-EQTQLSPG
Q5EY83_E1B19K-03        --VTEDLRPDHLVLACTGAE------FGSSGEETD---------------
E1U5L6_E1B19K-04        --MEPESRPGP-----SGMN------VVQEGGVPTLPMQFESH-------
E1ARN8_E1B19K-04        --MEPESRPGP-----SGMN------VVQEGGVPTLPMQFESH-------
Q5GFC7_E1B19K-05        --RESESRPGP-----S------------GGGVADLPCVWM---------
Q2KSG6_E1B19K-05        --REPESRPGP-----S-----------GGGGVADLPCV-----------
Q2KSM8_E1B19K-05        --REPESRPGP-----SG----------GGGGVADLPCVWM---------
                                                                          

Q71BY5_E1B19K-03        NLQDLPGVLKWCLLS-----------------------------------
Q71BY5_E1B19K-01        ------------------------RAVECIEDLLNEPGQPLDLSCKRPRP
Q71BY5_E1B19K-02        ------------------------RAVECIEDLLNEPGQPLDLSCKRPRP
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        FDLS---VELYKVIRYDD-TRHRCRQCECGSSHLELRPVLLNVT-EELRS
A0A5H2QAX5_E1B19K-      FDLS---VELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNVT-EELRS
T1UEX7_E1B19K-02        FDLS---VELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNVT-EELRS
M0QU02_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
Q695T5_E1B19K-02        FDIS---MVVYKILRY-DDCRARTRTCDCGASHLCNLTVMGMVT-EEVRL
P04492_E1B19K-02        FDLS---VELCKVIRYNDDTRHRCRQCECGSSHLELRPIVLNVT-EELRS
A0MK43_E1B19K-02        FDMS---MELFKVIRY-DETKSRCRSCECGANHLRLYPVTLNVT-EELRT
A0A482EVC6_E1B19K-      FDLT---IELYKVVRY-DELKARCRPCECGANHIRLYPATLNVT-EQLRT
A0A7D0TLU2_E1B19K-      FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
Q6VGV8_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
A0A0G2R248_E1B19K-      FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
A0A4P2SGW2_E1B19K-      FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
E1ARN8_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
E1U5L6_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
J9Z5H0_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
J9Z4N4_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
T1UG63_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
J7I6T8_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
J9Z4H6_E1B19K-02        FDMT---MKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
T1UGY3_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRA
A0A1P7YWR9_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A1P7YWY2_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A1P7YXN8_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A1P8C849_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UG22_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHSRMQPVALDVT-EELRP
A0A1P7YYY5_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUW8_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QVP5_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUS9_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
T1UKQ0_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QV47_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
T1UGU0_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
G1FBW4_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
F1DT57_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
E9P585_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
T1UKP8_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
W8CZB0_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
T1ULJ8_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUB4_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QVT4_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QVG6_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
T1UK99_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
C5HDR2_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A3S6PYX7_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A097I4T0_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QV87_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UKV6_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
F8UFP5_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EDLRP
T1UGT5_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A384ZUM9_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUJ3_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UHQ8_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UHH6_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UHL7_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A075TSZ1_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QVK6_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1ULP4_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
C4P207_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUN2_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
E1AI10_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A384ZUF2_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UHG3_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QTS5_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QV08_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QU76_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QU41_E1B19K-02        FDMD---VSVYKILRY-DETRSRVRACECGGRHTRMQPVALDVT-EELRP
M0QVC7_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A3Q9FFS0_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UGX3_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
T1UHZ2_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
A0A0G2UY10_E1B19K-      FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
M0QUF3_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
G1FC01_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
G3CK71_E1B19K-02        FDMD---VSVYKILRY-DETKSRVRACECGGRHTRMQPVALDVT-EELRP
I6LEP5_E1B19K-03        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
I6LES1_E1B19K-03        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
T2CI10_E1B19K-02        FDMN---LQIWKILRY-DDTKSRVRACECGGKHARFQPVCVDVT-EELRP
Q5GFC7_E1B19K-03        FDMN---VEVWKILRY-DEYKTRCRACECGGKHARFQPVCVDVT-EDLRP
Q6H1D7_E1B19K-02        FDMN---VEVWKILRY-DEYKTRCRACECGGKHARFQPVCVDVT-EDLRP
R4HLE1_E1B19K-02        FDMN---IQLWKILRY-DDTKSRVRACECGGKHARFQPVCVDVT-EDLRP
R4HLA0_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
J7ID56_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q5EY83_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
K7NG43_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
A0A0B4SJH1_E1B19K-      FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
A0A075IQ70_E1B19K-      FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
T1UIP3_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q2KRU2_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q2KS85_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q3ZKW2_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
R4HLJ6_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
R4HMC6_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
A0A897JQR0_E1B19K-      FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q2KSL3_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q2Y0J3_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
I1V161_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
Q6RK98_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
A0A5P8KYF0_E1B19K-      FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
I6LEP5_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
I6LES1_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
J7I6Q4_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
J7I6S4_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
T1UF50_E1B19K-02        FDMN---IQLWKILRY-DDTKPRVRACECGGKHARFQPVCVDVT-EDLRP
T1UJX4_E1B19K-02        FDMN---TQIWKILRY-DDTRSRVRTCECGGKHARFQPVCVDVT-EDLRP
A0A7G5FB98_E1B19K-      FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
Q32UI6_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
J7I6W7_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
Q7T8D8_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
Q3ZL02_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
T1UFS4_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
W6EIX6_E1B19K-02        FDMN---MQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
T1UE63_E1B19K-02        FDMN---TQIWKILRY-DDTRSRVRACECGGKHARFQPVCVDVT-EDLRP
Q2KSG6_E1B19K-03        FDMN---VEVWKILRY-DEYKTRCRACECGGKHARFQPVCVNVT-EDLRP
Q2KSM8_E1B19K-03        FDMN---VEVWKILRY-DEYKTRCRACECGGKHARFQPVCVDVT-EDLRP
Q7T8D8_E1B19K-03        YYGSIMANST---------------------SSNNPSTLTQDKL-LVLLA
Q6RK98_E1B19K-03        YYGSIVANSS---------------------SSNNPSTLAEDKL-LVLLA
A0A0M4NHE0_E1B19K-      YTLDYISLQLWRFWLR------------RRVYNYSRGLPPLGLA-SVAEE
H9AAK5_E1B19K-01        YTLDYISLQLWRFWLR------------RRVYNYSRGLPPLGLA-SVAEE
G0ZAH2_E1B19K-01        YRLDCLALAIWKHTLR-EGILRGVMQGPRARVNREIRREVEERL-TQVQR
A0A3Q9HK00_E1B19K-      YLLDFLAMHLWRAVVR---------HKNRLLLLSSVRPAIIPTE-E----
A0A3Q9HK78_E1B19K-      YLLDFLAMHLWRAVVR---------HKNRLLLLSSVRPAIIPTE-E----
A0A3S9SPV1_E1B19K-      YLLDFLAMHLWRAVVR---------HKNRLLLLSSVRPAIIPTE-EQQQQ
Q2KSM8_E1B19K-04        GVFD-MNVEVWKILRY-DEYKTRCRACECGGKHARFQPVCVDVT-EDLRP
Q2KSG6_E1B19K-04        GVFD-MNVEVWKILRY-DEYKTRCRACECGGKHARFQPVCVNVT-EDLRP
Q5GFC7_E1B19K-04        GVFD-MNVEVWKILRY-DEYKTRCRACECGGKHARFQPVCVDVT-EDLRP
E1U5L6_E1B19K-03        GVFD-MTMKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
E1ARN8_E1B19K-03        GVFD-MTMKIWKVLRY-DETRTRCRPCECGGKHIRNQPVMLDVT-EELRP
A0A1W5PVU4_E1B19K-      YTLDYISLQLWKAYMR-KG---KI-------YTFSQGPRSLPQR-VRRRL
A0A0M3TH18_E1B19K-      YTLDYISLQLWKAYMR-KG---KI-------YTFSQGPRSLPQ----RVR
A0A097IW62_E1B19K-      YTLDYITLQLWKAYMR-KG---KI-------YTFSREPRSLQRL-QTSLR
A0A0A1EUE4_E1B19K-      YMLDYLAMALWRAMLR-RR---VC-------IYSRAQPPRLDRV-VEEDE
A0A2H5AI40_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AID8_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AII9_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIL0_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIN5_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIS9_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIT6_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIU0_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A2H5AIC5_E1B19K-      YMLDYMAMALWRAMLR-RR---VC-------IYLRAQPPRLDRV-VEENE
A0A0G2UY10_E1B19K-      YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
X4Y9D2_E1B19K-01        YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
C5HDR2_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AVPGL-LRLHR
M0QVC7_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
A0A3S6PYX7_E1B19K-      YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
Q4KSL0_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A1P7YYY5_E1B19K-      YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
A0A1P8C849_E1B19K-      YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AALGL-LHLHR
B9A5L5_E1B19K-01        YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
T1UGY3_E1B19K-01        YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
A0A1P7YWR9_E1B19K-      YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
A0A1P7YWY2_E1B19K-      YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
A0A1P7YXN8_E1B19K-      YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
B9A5A7_E1B19K-01        YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
T1UG22_E1B19K-01        YILDFAAMHLWRAWMR-QRGQRIL-------NYWLLQP-AASGL-LHLHR
H5T740_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A1J0MS84_E1B19K-      YILDFAAMHLWRSWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A097I4T0_E1B19K-      YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
E5RWD9_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
M0QU76_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
B9A5T7_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
A0A7R6T9I9_E1B19K-      YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
D3GBW3_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AVPGL-LRLHR
M0QUF3_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
E5RWL1_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
B6C6W8_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
M0QU41_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
F1DT57_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
B2VQE3_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
B9A681_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
A0A1Y1BYF1_E1B19K-      YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
B6DU90_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
T1UHZ2_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
A0A3Q9FFS0_E1B19K-      YILDFAAMHLWRAWVR-QRGQRIL-------NYWLIQP-AAPGL-LRLHR
T1ULJ8_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UHG3_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LCLHR
E9P585_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A1Y1BXT7_E1B19K-      YILDFAAMHLWRAWIR-QRGQKIL-------NYWLLQP-AAPGL-LRLHR
T1UHL7_E1B19K-01        YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A075TSZ1_E1B19K-      YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UHH6_E1B19K-01        YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UKP8_E1B19K-01        YILDFAAMHLWRSWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
B9A5Q1_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QUB4_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QUJ3_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QUN2_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
C4P207_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
E1CIM6_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
D4N3H6_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QVK6_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QVT4_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
E1AI10_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
H0PPE7_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A3G8WIY5_E1B19K-      YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
Q9YL99_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
K7ZLN6_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A384ZUF2_E1B19K-      YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPVL-LRLHR
A0A384ZUM9_E1B19K-      YILDFAAMHLWRAWIR-QRGQRIL-------SYWLLQP-AAPGL-LRLHR
E1CIR1_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UHQ8_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1ULP4_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
A0A291B0H2_E1B19K-      YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
W8VNG2_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LHLHR
F8UFP5_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LHLHR
M0QV87_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AVPGL-LRLHR
M0QU02_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AAPGL-LHLHR
T1UKV6_E1B19K-01        YILDFAAMHLWRAWIR-QRGQRIL-------NYWLLQP-AVPGL-LRLHR
M0QV47_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QUW8_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
E1CIJ0_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UGU0_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QVG6_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
X4YVU5_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QUS9_E1B19K-01        YILDFTAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
G1FBW4_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QVP5_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UKQ0_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
W8CZB0_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
G1FC01_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
G3CK71_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UGT5_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AVPGL-LRLHR
T1UK99_E1B19K-01        YILDFTAMHLWKAWVR-QRGQRIL-------NYWLLQP-AAPGL-LHLHR
M0QTS5_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
M0QV08_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
G9JUV5_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
T1UGX3_E1B19K-01        YILDFAAMHLWRAWVR-QRGQRIL-------NYWLLQP-AAPGL-LRLHR
Q7T951_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
T1UE63_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
Q7T8D8_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
Q8B8U7_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
Q5UW22_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
W6EIX6_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
Q3ZL02_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
A0A1L7NRH1_E1B19K-      YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
T1UFS4_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
Q32UI6_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
A0A7G5F9T0_E1B19K-      YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHLP
C7SRS7_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
J7H4R9_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
D2DM83_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
A0A7U3S1T6_E1B19K-      YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
A0A7U3S224_E1B19K-      YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
J7I6W7_E1B19K-01        YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
T1UJX4_E1B19K-01        YVLDFIATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
A0A7G5FB98_E1B19K-      YVLDFVATALWRTWKV-RKMRTIL-------GYWPVQPLGVAGI-LRHPP
T2CI10_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A0K0PX99_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A0K0PX35_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
J7ID56_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A0B4SJH1_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A075IQ70_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q2KS85_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q3ZKW2_E1B19K-01        YVLDFIAAALWRTWKA-RSMRTIL-------DYWPVQPLGVAGI-LRHPP
K7NG43_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q2KRU2_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A8B0LCV0_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
T1UIP3_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A8B0L9Y2_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A6M6AA96_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A220VZ73_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
A0A8B0LD36_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A8B0LBX6_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
R4HLE1_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
R4HMC6_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
A0A897JQR0_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
I1V161_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
P03248_E1B19K-02        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q6RK98_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A5P8KYF0_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
J7I6Q4_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
J7I6S4_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------NYWPVQPLGVAGI-LRHPP
R4HLJ6_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
R4HLA0_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q2KSL3_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q2Y0J3_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
A0A5J6CTQ0_E1B19K-      YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q5EY83_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
I6LEP5_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
I6LES1_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
T1UF50_E1B19K-01        YVLDFIAAALWRTWKA-RRMRTIL-------DYWPVQPLGVAGI-LRHPP
Q6QPF3_E1B19K-01        YRLDCLAVALWRTWRC-QRLNAIS-------GYLPVQPVDTLRI-LSLQS
Q6QPB7_E1B19K-01        YRLDCLAVALWRTWRC-QRLNAIS-------GYLPVQPVDTLRI-LSLQS
Q6QPI9_E1B19K-01        YRLDCLAVALWRTWRC-QRLNAIS-------GYLPVQPVDTLRI-LSLQS
P10406_E1B19K-01        YQLDFLAVALWRTWKC-QRLNAIP-------ATCRYSR------------
Q5GFC7_E1B19K-02        YQLDFLAVALWRTWKC-QRLNAIP-------ATCRYSR------------
A0A2R3WN62_E1B19K-      YQLDFLAVALWRTWKC-QRLNAIP-------ATCRYSR------------
A0A3G9JTX5_E1B19K-      YQLDFLAVALWRAWKC-QRLNAIP-------ATCRYSR------------
Q2KSM8_E1B19K-02        YQLDFLAVALWRAWKC-QRLNAIP-------ATCRYSR------------
A0A2R3WNP3_E1B19K-      YQLDFLAVALWRAWKC-QRLNAIP-------ATCRYSR------------
Q2KSG6_E1B19K-02        YQLDFLAVALWRAWKC-QRLNAI----------CRYSR------------
A0A2L1F392_E1B19K-      YQLDFLAVALWRAWKC-QRLNAI----------CRYSR------------
A0A3G9CMQ4_E1B19K-      YQLDFLAVALWRTWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQ-
Q5GFC7_E1B19K-01        YQLDFLAVALWRTWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQ-
Q5GFC8_E1B19K-01        YQLDFLAVALWRTWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQ-
Q6H1D7_E1B19K-01        YQLDFLAVALWRTWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQ-
A0A3G8W6L2_E1B19K-      YQLDFLAVALWRAWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQQ
A0A3G9K5X3_E1B19K-      YQLDFLAVALWRAWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQQ
Q2KSG6_E1B19K-01        YQLDFLAVALWRAWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQQ
Q2KSM8_E1B19K-01        YQLDFLAVALWRAWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQQ
A0A2R3WN16_E1B19K-      YQLDFLAVALWRAWKC-QRLNAIS-------GYLPVQPLDTLRI-LSLQQ
G9G841_E1B19K-01        YQLDFLAVALWRTWKS-QRLNAIS-------GYLPVQPLDTLKI-LNLQE
Q8UY91_E1B19K-01        YQLDFLAVALWRTWKC-QRLNAIS-------GYLPVQPLDTLRI-LNLQE
D3JIR7_E1B19K-01        YMLDYMAMQLWRAWLT-RR-VCI--------YSLARPLT-MPRL-P----
A0A076V686_E1B19K-      YMLDYMTMQLWRAWLT-RR-VCI--------YSLARPLT-MPRL-P----
A0A5H2QAX5_E1B19K-      YMLDYMTMHLWRAWLK-RR-VCI--------YSLARPLT-MPPL------
G1DE13_E1B19K-01        YMLDYMAMHLWRAWLK-RR-VCI--------YSLARPLT-MPPL------
D0Z5R9_E1B19K-01        YMLDYMAMHLWRAWLK-RR-VCI--------YSLARPLT-MPPL------
T1UEX7_E1B19K-01        YMLDYMAMHLWRAWLK-RR-VCI--------YSLARPLT-MPPL------
A0A3G8WH01_E1B19K-      YMLDYMSMQLWRAWLK-RR-VCI--------YSLARPLT-MPPL-P----
P04492_E1B19K-01        YMLDYMSMQLWRAWLK-RR-VCI--------YSLARPLT-MPPL-P----
A0A2H5AI99_E1B19K-      YMLDYLSMAVWRAML--RK-RVCI-------YLRAQPPR-LDRV-E----
A0A0M3TH31_E1B19K-      YMLDYMTMALWRALLR-RR-RACI-------YLPVQPQRGLERV-E----
M9YXY5_E1B19K-01        YMLDYMTMALWRALLR-RR-RACI-------YLPVQPQRGLERV-E----
M9YVF6_E1B19K-01        YMLDYMTMALWRALLR-RR-RACI-------YLPVQPQQGLERV-E----
A0MK43_E1B19K-01        YMLDYMAMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-V----
A0A2H5AI21_E1B19K-      YMLDYMAMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-V----
A0A0M5L3Y4_E1B19K-      YMLDYMAMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-V----
Q5C8R2_E1B19K-01        YMLDYMAMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-V----
A0A0A1EUB2_E1B19K-      YMLDYMSMALWRAMLR-RR-VCI--------YLRAQPPR-LGRV-E----
A0A0A1EUC8_E1B19K-      YMLDYMSMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-E----
A0A2H5AI04_E1B19K-      YMLDYMSMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-E----
A0A2H5AI72_E1B19K-      YMLDYMSMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-E----
A0A2H5AIL3_E1B19K-      YMLDYMSMALWRAMLR-RR-VCI--------YLRAQPPR-LDRV-E----
A0A2H4CJZ0_E1B19K-      YTLDYLTMSLWRAMLR-KR-RVSG-------FSPARPPHGLDPV-L----
H8PFZ1_E1B19K-01        YTLDYLTMSLWRAMLR-KR-RVSG-------FSPARPPHGLDPV-L----
A0A7U3RVU4_E1B19K-      YTLDYMAMALWRTLLR-RK-RVLG-------CLPAQRPHGLDPV-Q----
A0A142G3J2_E1B19K-      YTLDYMAMALWRTLLR-RK-RVLG-------CLPAQRPHGLDPV-Q----
P10543_E1B19K-01        YTLDYMAMALWRTLLR-RK-RVLG-------CLPAQRPHGLDPV-Q----
A0A6M6AEV2_E1B19K-      YTLDYMAMALWRTLLR-RK-RVLG-------CLPAQRPHGLDPV-Q----
A0A7U3RWV6_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPT-V----
A0A1S6ELT2_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A3G4W995_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A898KBW7_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A482EVC6_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
B5SNR1_E1B19K-01        YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
P10544_E1B19K-01        YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
W0S1G8_E1B19K-01        YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A3G8W407_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A898KBS1_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
F4ZCJ8_E1B19K-01        YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A898KBR0_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A6B9DS29_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A6M6AES6_E1B19K-      YTLDYMTMALWRTLLR-RK-RVLG-------CSPAQPPHGLDPV-R----
A0A7L4WGT1_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3S9SP19_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A291P1B2_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A5K6WAR5_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
T1UG63_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E---Q
A0A1U9ALK7_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A6M5E4Y6_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
P03247_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3G8W3H5_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
E1U5L6_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A516UYI9_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
J9Z5H0_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3S9SND6_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRML-------LLSSVRPAIIPTE-E----
J9Z4N4_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3Q9HJZ5_E1B19K-      YLLDFLAMHLWRAVVR-HK-NGLL-------LLSSVRPAIIPTE-E---Q
A0A513TZR1_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRML-------LLSSVRPAIIPTE-E---Q
A0A516UYM9_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E---Q
A0A7L4WG90_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E-QQQ
J9Z4H6_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E---Q
A0A6M4W5T4_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A7L4WIG2_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
J7I6T8_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A7L4WK62_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRML-------LLSSVRPAIIRTE-E----
A0A3S9SNH4_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRML-------LLSSVRPAIIPTE-E----
Q6WQ37_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A7D0TN91_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
Q6VGV8_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A0G2R248_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3Q9HJ54_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3S9SSS2_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIPTEE-Q----
A0A3S9SNY0_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVSPAIIPTE-E----
A0A2H4PJ75_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A7D6TSN5_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E--QQ
Q71BY5_E1B19K-04        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A4P2SGW2_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
A0A3Q9HJ63_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E--QQ
A0A7L4WIC2_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLI-------LLSSVRPAIIPTE-Q--QQ
A0A7L4WJT1_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-EQQQQ
A0A3Q9HLF7_E1B19K-      YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVSPAIIPTE-E----
E1ARN8_E1B19K-01        YLLDFLAMHLWRAVVR-HK-NRLL-------LLSSVRPAIIPTE-E----
P06501_E1B19K-01        YQMDYISLNLWKFWLR-RR-VYNY-------SRGL---PQLGPA-APLAR
A0A0M4N3Z1_E1B19K-      YQMDYISLNLWKFWLR-RR-VYNY-------SRGL---PQLGPV-APLVR
Q8B6X5_E1B19K-01        YQMDYIRLNLWKFWLR-RR-VYNY-------SRGL---PQLGPV-APLVR
H9AAD9_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGLA-SVAEE
H9AAH3_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGLA-SVAEE
H9AAA8_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
M9YVA3_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
F2WTJ7_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SLPEE
F2WTM9_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SLPEE
H9AA76_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
A0A1C8EG46_E1B19K-      YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
H9AAN8_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
H9AAS0_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
H9AAV3_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
H9AAY5_E1B19K-01        YTLDYISLQLWRFWLR-RR-VYNY-------SRGL---PPLGRA-SSPEE
A0A1L3INW0_E1B19K-      YTLDFLTLSLWKTGLK-RG-RKLY-------GRMLERHPSLIQK-TVRAQ
F6KST6_E1B19K-01        YTLDFLTLCLWKFGIR-KG-RKLY-------RRLVERHPSLRQH-RLQAQ
F2WTG5_E1B19K-01        YTLDFLTLCLWKFGIR-RG-RKLY-------GRLVERHPSLRQQ-RLQAQ
Q695T5_E1B19K-01        YTLDFLTLCLWKFGIR-RG-RKLY-------GRLVERHPSLRQQ-RLQAQ
H9TER0_E1B19K-01        YTLDFLTLCLWKFGIR-RG-RKLY-------GRLVERHPSLRQQ-RLQAQ
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        DHLTLSCLRTDYESSDEDGN------------------------------
A0A5H2QAX5_E1B19K-      DHLTLSCLRTDYDSSDEDN-------------------------------
T1UEX7_E1B19K-02        DHLTLSCLRTDYESSDEDN-------------------------------
M0QU02_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
Q695T5_E1B19K-02        DHCQHSCLREEFSSSDEED-------------------------------
P04492_E1B19K-02        DHLTLSCLRTDYESSDEDDN------------------------------
A0MK43_E1B19K-02        DHHMLSCLRTDYESSDEE--------------------------------
A0A482EVC6_E1B19K-      DHQMLSCLRTDYESSDED--------------------------------
A0A7D0TLU2_E1B19K-      DHLVLACTRAEFGSSDEDTD------------------------------
Q6VGV8_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
A0A0G2R248_E1B19K-      DHLVLACTRAEFGSSDEDTD------------------------------
A0A4P2SGW2_E1B19K-      DHLVLACTRAEFGSSDEDTD------------------------------
E1ARN8_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
E1U5L6_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
J9Z5H0_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
J9Z4N4_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
T1UG63_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
J7I6T8_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
J9Z4H6_E1B19K-02        DHLVLACTRAEFGSSDEDTD------------------------------
T1UGY3_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A1P7YWR9_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
A0A1P7YWY2_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
A0A1P7YXN8_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
A0A1P8C849_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
T1UG22_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A1P7YYY5_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
M0QUW8_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QVP5_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QUS9_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UKQ0_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QV47_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UGU0_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
G1FBW4_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
F1DT57_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
E9P585_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UKP8_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
W8CZB0_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1ULJ8_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QUB4_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QVT4_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QVG6_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UK99_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
C5HDR2_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A3S6PYX7_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
A0A097I4T0_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
M0QV87_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UKV6_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
F8UFP5_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UGT5_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A384ZUM9_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
M0QUJ3_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UHQ8_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UHH6_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UHL7_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A075TSZ1_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
M0QVK6_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1ULP4_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
C4P207_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QUN2_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
E1AI10_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A384ZUF2_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
T1UHG3_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QTS5_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QV08_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QU76_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QU41_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
M0QVC7_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A3Q9FFS0_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
T1UGX3_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
T1UHZ2_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
A0A0G2UY10_E1B19K-      DHLVMACTGTEFSSSGEDTD------------------------------
M0QUF3_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
G1FC01_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
G3CK71_E1B19K-02        DHLVMACTGTEFSSSGEDTD------------------------------
I6LEP5_E1B19K-03        DHLVLACTGAEFGSSGEETD------------------------------
I6LES1_E1B19K-03        DHLVLACTGAEFGSSGEETD------------------------------
T2CI10_E1B19K-02        DHLVIACTGAEFGSSGEETD------------------------------
Q5GFC7_E1B19K-03        DHLVLSCTGTEFGSSGEESD------------------------------
Q6H1D7_E1B19K-02        DHLVLSCTGTEFGSSGEESD------------------------------
R4HLE1_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
R4HLA0_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
J7ID56_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q5EY83_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
K7NG43_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
A0A0B4SJH1_E1B19K-      DHLVLACTGAEFGSSGEETD------------------------------
A0A075IQ70_E1B19K-      DHLVLACTGAEFGSSGEETD------------------------------
T1UIP3_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q2KRU2_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q2KS85_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q3ZKW2_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
R4HLJ6_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
R4HMC6_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
A0A897JQR0_E1B19K-      DHLVLACTGAEFGSSGEETD------------------------------
Q2KSL3_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q2Y0J3_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
I1V161_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
Q6RK98_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
A0A5P8KYF0_E1B19K-      DHLVLACTGAEFGSSGEETD------------------------------
I6LEP5_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
I6LES1_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
J7I6Q4_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
J7I6S4_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
T1UF50_E1B19K-02        DHLVLACTGAEFGSSGEETD------------------------------
T1UJX4_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
A0A7G5FB98_E1B19K-      DHLVIARTGAEFGSSGEETD------------------------------
Q32UI6_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
J7I6W7_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
Q7T8D8_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
Q3ZL02_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
T1UFS4_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
W6EIX6_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
T1UE63_E1B19K-02        DHLVIARTGAEFGSSGEETD------------------------------
Q2KSG6_E1B19K-03        DHLVLSCTGTEFGSSGEESD------------------------------
Q2KSM8_E1B19K-03        DHLVLSCTGTEFGSSGEESD------------------------------
Q7T8D8_E1B19K-03        QLEALTQRLGELSQQVVELR------------VQTESAVGTAKSK-----
Q6RK98_E1B19K-03        QLEALTQRLGELSKQVAQLR------------EQTESAVATAKSK-----
A0A0M4NHE0_E1B19K-      RSEESKPEVNPEAQGEAKEE----------------ALRSGLDPPVEED-
H9AAK5_E1B19K-01        RSEESKPEVNPEAQGEAKEE----------------TLRSGLDPPVEEN-
G0ZAH2_E1B19K-01        ELEERERERQQREREQQQQEGEMTTSIWRPSMEAEWPPRAGMDPPLEEQW
A0A3Q9HK00_E1B19K-      -QQQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE----
A0A3Q9HK78_E1B19K-      --QQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE----
A0A3S9SPV1_E1B19K-      QQQQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE----
Q2KSM8_E1B19K-04        D------------------H------------LVLSCTGTEFGSSGEESD
Q2KSG6_E1B19K-04        D------------------H------------LVLSCTGTEFGSSGEESD
Q5GFC7_E1B19K-04        D------------------H------------LVLSCTGTEFGSSGEESD
E1U5L6_E1B19K-03        D------------------H------------LVLACTRAEFGSSDEDTD
E1ARN8_E1B19K-03        D------------------H------------LVLACTRAEFGSSDEDTD
A0A1W5PVU4_E1B19K-      GFQTEDQTRL---------L------------EAEEEPRAGMDPPSET--
A0A0M3TH18_E1B19K-      RRLGFKTEDQTRL------L------------EAEEEPRAGTDPPSET--
A0A097IW62_E1B19K-      RRLGMPTDDRVCL------L------------EA-ENPRAGMDPPSEN--
A0A0A1EUE4_E1B19K-      -------------------P------------DETENLRAGLDPPMED--
A0A2H5AI40_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AID8_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AII9_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIL0_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIN5_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIS9_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIT6_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIU0_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A2H5AIC5_E1B19K-      -------------------P------------EETENLRAGLDPPVED--
A0A0G2UY10_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
X4Y9D2_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
C5HDR2_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QVC7_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A3S6PYX7_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
Q4KSL0_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A1P7YYY5_E1B19K-      QTSMLEEEIR---------E------------AMDKNPRSGLDPPLEEEL
A0A1P8C849_E1B19K-      QTSMLEEEMR---------E------------AMDKNPRSGLDPPSEEEL
B9A5L5_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
T1UGY3_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
A0A1P7YWR9_E1B19K-      QTSMLEEEMR---------E------------AMDKNPRSGLDPPSEEEL
A0A1P7YWY2_E1B19K-      QTSMLEEEMR---------E------------SMDKNPRSGLDPPSEEEL
A0A1P7YXN8_E1B19K-      QTSMLEEEMR---------E------------AMDKNPRSGLDPPSEEEL
B9A5A7_E1B19K-01        QTSMLEEEMR---------E------------AMDKNPRSGLDPPSEEEL
T1UG22_E1B19K-01        QTSMLEEEMR---------E------------AMDKNPRSGLDPPSEEEL
H5T740_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A1J0MS84_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A097I4T0_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPPEEEL
E5RWD9_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QU76_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B9A5T7_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A7R6T9I9_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
D3GBW3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QUF3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
E5RWL1_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B6C6W8_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QU41_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
F1DT57_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B2VQE3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B9A681_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A1Y1BYF1_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B6DU90_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UHZ2_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A3Q9FFS0_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1ULJ8_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UHG3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
E9P585_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPLEEEL
A0A1Y1BXT7_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UHL7_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A075TSZ1_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UHH6_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UKP8_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
B9A5Q1_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QUB4_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QUJ3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QUN2_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
C4P207_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
E1CIM6_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
D4N3H6_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QVK6_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QVT4_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
E1AI10_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
H0PPE7_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A3G8WIY5_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
Q9YL99_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
K7ZLN6_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A384ZUF2_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A384ZUM9_E1B19K-      QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
E1CIR1_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UHQ8_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1ULP4_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
A0A291B0H2_E1B19K-      QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
W8VNG2_E1B19K-01        QTSMLEEEMR---------E------------AMDDNPRSGLDPPSEEEL
F8UFP5_E1B19K-01        QTSMLEEEMR---------E------------AMDDNPRSGLDPPSEEEL
M0QV87_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QU02_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
T1UKV6_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QV47_E1B19K-01        QTSMLEEEMR---------E------------TMDENPRSGLDPPSEEEL
M0QUW8_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
E1CIJ0_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
T1UGU0_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QVG6_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
X4YVU5_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QUS9_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
G1FBW4_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QVP5_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
T1UKQ0_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
W8CZB0_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
G1FC01_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
G3CK71_E1B19K-01        QTSMLEEEMR---------Q------------AMYENPRSGLDPPSEEEL
T1UGT5_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
T1UK99_E1B19K-01        QTSMLEEEMR---------E------------AMDENPRSGLDPPSEEEL
M0QTS5_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
M0QV08_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
G9JUV5_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
T1UGX3_E1B19K-01        QTSMLEEEMR---------Q------------AMDENPRSGLDPPSEEEL
Q7T951_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
T1UE63_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
Q7T8D8_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
Q8B8U7_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
Q5UW22_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
W6EIX6_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
Q3ZL02_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A1L7NRH1_E1B19K-      VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
T1UFS4_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
Q32UI6_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A7G5F9T0_E1B19K-      VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
C7SRS7_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
J7H4R9_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
D2DM83_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A7U3S1T6_E1B19K-      VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A7U3S224_E1B19K-      VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
J7I6W7_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
T1UJX4_E1B19K-01        VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A7G5FB98_E1B19K-      VMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
T2CI10_E1B19K-01        TMPAVLEE-----------E------------HQEDNPRVGLDPPVEEAE
A0A0K0PX99_E1B19K-      AMPAVLEE-----------E------------QQEDNPRAGLDPPVEEAE
A0A0K0PX35_E1B19K-      AMPSVLEE-----------E------------QQEDNPRAGLDPPVEEAE
J7ID56_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A0B4SJH1_E1B19K-      AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
A0A075IQ70_E1B19K-      AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
Q2KS85_E1B19K-01        AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
Q3ZKW2_E1B19K-01        TMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
K7NG43_E1B19K-01        AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
Q2KRU2_E1B19K-01        AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
A0A8B0LCV0_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
T1UIP3_E1B19K-01        AMPAVLEE-----------E------------QQEDNPRAGLDPPVEE--
A0A8B0L9Y2_E1B19K-      --PAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A6M6AA96_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A220VZ73_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A8B0LD36_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A8B0LBX6_E1B19K-      TMPVVLQE-----------E------------QQEDNPRAGLDPPVEE--
R4HLE1_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
R4HMC6_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A897JQR0_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
I1V161_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
P03248_E1B19K-02        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
Q6RK98_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A5P8KYF0_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
J7I6Q4_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
J7I6S4_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
R4HLJ6_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
R4HLA0_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
Q2KSL3_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
Q2Y0J3_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
A0A5J6CTQ0_E1B19K-      TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
Q5EY83_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
I6LEP5_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
I6LES1_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
T1UF50_E1B19K-01        TMPAVLQE-----------E------------QQEDNPRAGLDPPVEE--
Q6QPF3_E1B19K-01        PQEHQRRQQPQQEQQQ--EE------------DREENPRAGLDPPVAEEE
Q6QPB7_E1B19K-01        PQEHQRRQQPQQEQQQEEEE------------DREENPRAGLDPPVAEEE
Q6QPI9_E1B19K-01        PQEHQRRQQPQQEQQQ--EE------------DREENLRAGLDPPVAEEE
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------QQ---E------------DQEENPRAGLDPPAEE--
Q5GFC7_E1B19K-01        --------------QQ---E------------DQEENPRAGLDPPAEE--
Q5GFC8_E1B19K-01        --------------QQ---E------------DQEENPRAGLDPPAEE--
Q6H1D7_E1B19K-01        --------------QQ---E------------DQEENPRAGLDPPAEE--
A0A3G8W6L2_E1B19K-      ISQERQRR----QRQQ---E------------DQEENPRAGLDPPAEEEE
A0A3G9K5X3_E1B19K-      ISQERQRR----QQQQ---E------------DQEENPRAGLDPPAEEE-
Q2KSG6_E1B19K-01        ISQERQRR----QQQQ---E------------DQEENPRAGLDPPAEEE-
Q2KSM8_E1B19K-01        ISQERQRR----QQQQ---E------------DQEENPRAGLDPPAEEEE
A0A2R3WN16_E1B19K-      ISQERQRR----QQQQ---E------------DQEENPRAGLDPPAEEEE
G9G841_E1B19K-01        SPRARQRRRQQQRQQE---E------------DQEENPRAGLDPPAEEE-
Q8UY91_E1B19K-01        SPRARQRR--QQQQQE---E------------DQEENPRAGLDPPAEEEE
D3JIR7_E1B19K-01        ----------TLQEEEL--E------------QRDPAAEK----------
A0A076V686_E1B19K-      ----------TLQEEP---E------------ERDPAVEK----------
A0A5H2QAX5_E1B19K-      ----------------Q--E------------EQQNTTTEE---------
G1DE13_E1B19K-01        ----------------Q--E------------EQQNTTTEE---------
D0Z5R9_E1B19K-01        ----------------Q--E------------EQQNTTTEE---------
T1UEX7_E1B19K-01        ----------------Q--E------------EQQNTTTEE---------
A0A3G8WH01_E1B19K-      ----------TLQEEKE--E------------ERNPAVVEK---------
P04492_E1B19K-01        ----------TLQEEKE--E------------ERNPAVVEK---------
A0A2H5AI99_E1B19K-      -------------EEDE--P------------VETDNPRAGLDPPVED--
A0A0M3TH31_E1B19K-      -------------EEEE----------------ENENPRAGVDPPLE---
M9YXY5_E1B19K-01        -------------EEEE----------------ENENPRAGVDPPLE---
M9YVF6_E1B19K-01        -------------EEEE------------------ENPRAGVDPPLE---
A0MK43_E1B19K-01        -------------EENE--P------------EETENLRAGLDPPVED--
A0A2H5AI21_E1B19K-      -------------EENE--P------------EETENLRAGLDPPVED--
A0A0M5L3Y4_E1B19K-      -------------EENE--P------------EETENLRAGLDPPVED--
Q5C8R2_E1B19K-01        -------------EENE--P------------EETENLRAGLDPPVED--
A0A0A1EUB2_E1B19K-      -------------EEDE--P------------GEMENLRAGLDPPTED--
A0A0A1EUC8_E1B19K-      -------------EEDE--P------------GETENLRAGLDPPTED--
A0A2H5AI04_E1B19K-      -------------EEDE--P------------GETENLRAGLDPPTED--
A0A2H5AI72_E1B19K-      -------------EEDE--P------------GETENLRAGLDPPTED--
A0A2H5AIL3_E1B19K-      -------------EEDE--P------------GETENLRAGLDPPTED--
A0A2H4CJZ0_E1B19K-      -------------EEPE--P------------EEEENPRAGLDPSAE---
H8PFZ1_E1B19K-01        -------------EESE--L------------EEEENPRAGLDPPAE---
A0A7U3RVU4_E1B19K-      -------------EEEE--E------------EEEENLRAGLDPSTEL--
A0A142G3J2_E1B19K-      ---------------EE--E------------EEEENLRAGLDPSTEL--
P10543_E1B19K-01        ---------------EE--E------------EEEENLRAGLDPSTEL--
A0A6M6AEV2_E1B19K-      ---------------EE--E------------EEEENLRAGLDPSTEL--
A0A7U3RWV6_E1B19K-      -------------REEE--E------------EGEEN-------------
A0A1S6ELT2_E1B19K-      ------------EEEEE--E------------EERENLRAGLDPQTEL--
A0A3G4W995_E1B19K-      ----------------E--E------------EEEENLRAGLDPQTEL--
A0A898KBW7_E1B19K-      ----------EEEEEEE--E------------EEEENLRAGLDPQTEL--
A0A482EVC6_E1B19K-      ------------EEEEE--E------------EEEENLRAGLDPQTEL--
B5SNR1_E1B19K-01        ------------EEEEE--E------------EEEENLRAGLDPQTEL--
P10544_E1B19K-01        --------------EEE--E------------EEEENLRAGLDPQTEL--
W0S1G8_E1B19K-01        --------------EEE--E------------EEEENLRAGLDPQTEL--
A0A3G8W407_E1B19K-      -------------------E------------EEEENLRAGLDPQTEL--
A0A898KBS1_E1B19K-      -------------EEEE--E------------EEEENLRAGLDPQTEL--
F4ZCJ8_E1B19K-01        -----------EEEEEE--E------------EEEENLRAGLDPQTEL--
A0A898KBR0_E1B19K-      ---------------EE--E------------EEEENLRAGLDPQTEL--
A0A6B9DS29_E1B19K-      ---------------EE--E------------EEEENLRAGLDPQTEL--
A0A6M6AES6_E1B19K-      -------------------E------------EEEENLRAGLDPQTEL--
A0A7L4WGT1_E1B19K-      ---------EARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3S9SP19_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A291P1B2_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A5K6WAR5_E1B19K-      ---QQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
T1UG63_E1B19K-01        QQQQQQQEEARRRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A1U9ALK7_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A6M5E4Y6_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
P03247_E1B19K-01        -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3G8W3H5_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
E1U5L6_E1B19K-01        -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A516UYI9_E1B19K-      -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
J9Z5H0_E1B19K-01        -----QQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3S9SND6_E1B19K-      -QQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
J9Z4N4_E1B19K-01        ---QQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3Q9HJZ5_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A513TZR1_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A516UYM9_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7L4WG90_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
J9Z4H6_E1B19K-01        QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A6M4W5T4_E1B19K-      -QQQQQQQEETRRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7L4WIG2_E1B19K-      -QQQQQLQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
J7I6T8_E1B19K-01        -QQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7L4WK62_E1B19K-      --QQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3S9SNH4_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
Q6WQ37_E1B19K-01        ----QQQQQEEARRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7D0TN91_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
Q6VGV8_E1B19K-01        ----QQQQQEEARRRRQ--E------------QSPWNPRAGLDPR-E---
A0A0G2R248_E1B19K-      ----QQQQQEEARRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3Q9HJ54_E1B19K-      ----QQQEEARRRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3S9SSS2_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3S9SNY0_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A2H4PJ75_E1B19K-      --QQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7D6TSN5_E1B19K-      QQQQQQQEEARRRRRRQ--E------------QSPWNPRAGLDPR-E---
Q71BY5_E1B19K-04        QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A4P2SGW2_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3Q9HJ63_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7L4WIC2_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A7L4WJT1_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
A0A3Q9HLF7_E1B19K-      QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
E1ARN8_E1B19K-01        QQQQQQQQEEARRRRRQ--E------------QSPWNPRAGLDPR-E---
P06501_E1B19K-01        QGSQQEE-QQQRQEEEQ--V------------QE--EMRSGLDPP-TEN-
A0A0M4N3Z1_E1B19K-      QGSQQEEQQQQRQEEQQ--V------------QEEGEMRSGLDPP-TEN-
Q8B6X5_E1B19K-01        QGSQQEEQQQQRQEEQQ--V------------QEEGEMRSGLDPP-TEN-
H9AAD9_E1B19K-01        RSEESKPEVNPEAQGEA--K------------E--ETLRSGLDPPVEEN-
H9AAH3_E1B19K-01        RSEESKPEVNPEAQGEA--K------------E--ETLRSGLNPPVEEN-
H9AAA8_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------EQKPALRSGLDPP-EEN-
M9YVA3_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------E--PALRSGLDPP-EEN-
F2WTJ7_E1B19K-01        QSPEVKPKVAGQGEEQE--Q------------E--PALRSGLDPP-EEKE
F2WTM9_E1B19K-01        QSPEVKPKVAGQGEEQE--Q------------E--PALRSGLDPP-EEKE
H9AA76_E1B19K-01        QSPEVKPEVAGQGEEQE--P------------E--PALRSGLDPP-EEN-
A0A1C8EG46_E1B19K-      QLPEVKPEVAGQGEEQE--Q------------K--PALRSGLGPP-EEN-
H9AAN8_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------E--PALRSGLDPP-EEN-
H9AAS0_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------E--PALRSGLDPP-EEN-
H9AAV3_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------E--PALRSGLDPP-EEN-
H9AAY5_E1B19K-01        QSPEVKPEVAGQGEEQE--Q------------E--PALRSGLDPP-EEN-
A0A1L3INW0_E1B19K-      VLSRWGALE----------N------------LAEEDPRAGLDPP-EEEV
F6KST6_E1B19K-01        ALLRQEELETILEEEAM--N------------MEEQNPRAGLDPP-VEA-
F2WTG5_E1B19K-01        VLLRREDLEAISEEES---G------------MEE-NPRAGLDPP-AEE-
Q695T5_E1B19K-01        VLLRREDLEAISEEES---G------------MEEKNPRAGLDPP-AEE-
H9TER0_E1B19K-01        VLLRREDLEAISEEES---G------------MEEKNPRAGLDPP-AEE-
Q5EY83_E1B19K-03        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------
Q71BY5_E1B19K-01        --------
Q71BY5_E1B19K-02        --------
P03248_E1B19K-03        --------
D3JIR7_E1B19K-02        --------
A0A5H2QAX5_E1B19K-      --------
T1UEX7_E1B19K-02        --------
M0QU02_E1B19K-02        --------
Q695T5_E1B19K-02        --------
P04492_E1B19K-02        --------
A0MK43_E1B19K-02        --------
A0A482EVC6_E1B19K-      --------
A0A7D0TLU2_E1B19K-      --------
Q6VGV8_E1B19K-02        --------
A0A0G2R248_E1B19K-      --------
A0A4P2SGW2_E1B19K-      --------
E1ARN8_E1B19K-02        --------
E1U5L6_E1B19K-02        --------
J9Z5H0_E1B19K-02        --------
J9Z4N4_E1B19K-02        --------
T1UG63_E1B19K-02        --------
J7I6T8_E1B19K-02        --------
J9Z4H6_E1B19K-02        --------
T1UGY3_E1B19K-02        --------
A0A1P7YWR9_E1B19K-      --------
A0A1P7YWY2_E1B19K-      --------
A0A1P7YXN8_E1B19K-      --------
A0A1P8C849_E1B19K-      --------
T1UG22_E1B19K-02        --------
A0A1P7YYY5_E1B19K-      --------
M0QUW8_E1B19K-02        --------
M0QVP5_E1B19K-02        --------
M0QUS9_E1B19K-02        --------
T1UKQ0_E1B19K-02        --------
M0QV47_E1B19K-02        --------
T1UGU0_E1B19K-02        --------
G1FBW4_E1B19K-02        --------
F1DT57_E1B19K-02        --------
E9P585_E1B19K-02        --------
T1UKP8_E1B19K-02        --------
W8CZB0_E1B19K-02        --------
T1ULJ8_E1B19K-02        --------
M0QUB4_E1B19K-02        --------
M0QVT4_E1B19K-02        --------
M0QVG6_E1B19K-02        --------
T1UK99_E1B19K-02        --------
C5HDR2_E1B19K-02        --------
A0A3S6PYX7_E1B19K-      --------
A0A097I4T0_E1B19K-      --------
M0QV87_E1B19K-02        --------
T1UKV6_E1B19K-02        --------
F8UFP5_E1B19K-02        --------
T1UGT5_E1B19K-02        --------
A0A384ZUM9_E1B19K-      --------
M0QUJ3_E1B19K-02        --------
T1UHQ8_E1B19K-02        --------
T1UHH6_E1B19K-02        --------
T1UHL7_E1B19K-02        --------
A0A075TSZ1_E1B19K-      --------
M0QVK6_E1B19K-02        --------
T1ULP4_E1B19K-02        --------
C4P207_E1B19K-02        --------
M0QUN2_E1B19K-02        --------
E1AI10_E1B19K-02        --------
A0A384ZUF2_E1B19K-      --------
T1UHG3_E1B19K-02        --------
M0QTS5_E1B19K-02        --------
M0QV08_E1B19K-02        --------
M0QU76_E1B19K-02        --------
M0QU41_E1B19K-02        --------
M0QVC7_E1B19K-02        --------
A0A3Q9FFS0_E1B19K-      --------
T1UGX3_E1B19K-02        --------
T1UHZ2_E1B19K-02        --------
A0A0G2UY10_E1B19K-      --------
M0QUF3_E1B19K-02        --------
G1FC01_E1B19K-02        --------
G3CK71_E1B19K-02        --------
I6LEP5_E1B19K-03        --------
I6LES1_E1B19K-03        --------
T2CI10_E1B19K-02        --------
Q5GFC7_E1B19K-03        --------
Q6H1D7_E1B19K-02        --------
R4HLE1_E1B19K-02        --------
R4HLA0_E1B19K-02        --------
J7ID56_E1B19K-02        --------
Q5EY83_E1B19K-02        --------
K7NG43_E1B19K-02        --------
A0A0B4SJH1_E1B19K-      --------
A0A075IQ70_E1B19K-      --------
T1UIP3_E1B19K-02        --------
Q2KRU2_E1B19K-02        --------
Q2KS85_E1B19K-02        --------
Q3ZKW2_E1B19K-02        --------
R4HLJ6_E1B19K-02        --------
R4HMC6_E1B19K-02        --------
A0A897JQR0_E1B19K-      --------
Q2KSL3_E1B19K-02        --------
Q2Y0J3_E1B19K-02        --------
I1V161_E1B19K-02        --------
Q6RK98_E1B19K-02        --------
A0A5P8KYF0_E1B19K-      --------
I6LEP5_E1B19K-02        --------
I6LES1_E1B19K-02        --------
J7I6Q4_E1B19K-02        --------
J7I6S4_E1B19K-02        --------
T1UF50_E1B19K-02        --------
T1UJX4_E1B19K-02        --------
A0A7G5FB98_E1B19K-      --------
Q32UI6_E1B19K-02        --------
J7I6W7_E1B19K-02        --------
Q7T8D8_E1B19K-02        --------
Q3ZL02_E1B19K-02        --------
T1UFS4_E1B19K-02        --------
W6EIX6_E1B19K-02        --------
T1UE63_E1B19K-02        --------
Q2KSG6_E1B19K-03        --------
Q2KSM8_E1B19K-03        --------
Q7T8D8_E1B19K-03        --------
Q6RK98_E1B19K-03        --------
A0A0M4NHE0_E1B19K-      --------
H9AAK5_E1B19K-01        --------
G0ZAH2_E1B19K-01        EADHDPEA
A0A3Q9HK00_E1B19K-      --------
A0A3Q9HK78_E1B19K-      --------
A0A3S9SPV1_E1B19K-      --------
Q2KSM8_E1B19K-04        --------
Q2KSG6_E1B19K-04        --------
Q5GFC7_E1B19K-04        --------
E1U5L6_E1B19K-03        --------
E1ARN8_E1B19K-03        --------
A0A1W5PVU4_E1B19K-      --------
A0A0M3TH18_E1B19K-      --------
A0A097IW62_E1B19K-      --------
A0A0A1EUE4_E1B19K-      --------
A0A2H5AI40_E1B19K-      --------
A0A2H5AID8_E1B19K-      --------
A0A2H5AII9_E1B19K-      --------
A0A2H5AIL0_E1B19K-      --------
A0A2H5AIN5_E1B19K-      --------
A0A2H5AIS9_E1B19K-      --------
A0A2H5AIT6_E1B19K-      --------
A0A2H5AIU0_E1B19K-      --------
A0A2H5AIC5_E1B19K-      --------
A0A0G2UY10_E1B19K-      D-------
X4Y9D2_E1B19K-01        D-------
C5HDR2_E1B19K-01        D-------
M0QVC7_E1B19K-01        D-------
A0A3S6PYX7_E1B19K-      D-------
Q4KSL0_E1B19K-01        D-------
A0A1P7YYY5_E1B19K-      D-------
A0A1P8C849_E1B19K-      D-------
B9A5L5_E1B19K-01        D-------
T1UGY3_E1B19K-01        D-------
A0A1P7YWR9_E1B19K-      D-------
A0A1P7YWY2_E1B19K-      D-------
A0A1P7YXN8_E1B19K-      D-------
B9A5A7_E1B19K-01        D-------
T1UG22_E1B19K-01        D-------
H5T740_E1B19K-01        D-------
A0A1J0MS84_E1B19K-      D-------
A0A097I4T0_E1B19K-      D-------
E5RWD9_E1B19K-01        D-------
M0QU76_E1B19K-01        D-------
B9A5T7_E1B19K-01        N-------
A0A7R6T9I9_E1B19K-      N-------
D3GBW3_E1B19K-01        D-------
M0QUF3_E1B19K-01        D-------
E5RWL1_E1B19K-01        D-------
B6C6W8_E1B19K-01        N-------
M0QU41_E1B19K-01        D-------
F1DT57_E1B19K-01        D-------
B2VQE3_E1B19K-01        D-------
B9A681_E1B19K-01        N-------
A0A1Y1BYF1_E1B19K-      N-------
B6DU90_E1B19K-01        D-------
T1UHZ2_E1B19K-01        N-------
A0A3Q9FFS0_E1B19K-      D-------
T1ULJ8_E1B19K-01        D-------
T1UHG3_E1B19K-01        D-------
E9P585_E1B19K-01        D-------
A0A1Y1BXT7_E1B19K-      D-------
T1UHL7_E1B19K-01        D-------
A0A075TSZ1_E1B19K-      D-------
T1UHH6_E1B19K-01        D-------
T1UKP8_E1B19K-01        D-------
B9A5Q1_E1B19K-01        D-------
M0QUB4_E1B19K-01        D-------
M0QUJ3_E1B19K-01        D-------
M0QUN2_E1B19K-01        D-------
C4P207_E1B19K-01        D-------
E1CIM6_E1B19K-01        D-------
D4N3H6_E1B19K-01        D-------
M0QVK6_E1B19K-01        D-------
M0QVT4_E1B19K-01        D-------
E1AI10_E1B19K-01        D-------
H0PPE7_E1B19K-01        D-------
A0A3G8WIY5_E1B19K-      D-------
Q9YL99_E1B19K-01        D-------
K7ZLN6_E1B19K-01        D-------
A0A384ZUF2_E1B19K-      D-------
A0A384ZUM9_E1B19K-      D-------
E1CIR1_E1B19K-01        D-------
T1UHQ8_E1B19K-01        D-------
T1ULP4_E1B19K-01        D-------
A0A291B0H2_E1B19K-      D-------
W8VNG2_E1B19K-01        D-------
F8UFP5_E1B19K-01        D-------
M0QV87_E1B19K-01        D-------
M0QU02_E1B19K-01        D-------
T1UKV6_E1B19K-01        D-------
M0QV47_E1B19K-01        D-------
M0QUW8_E1B19K-01        D-------
E1CIJ0_E1B19K-01        D-------
T1UGU0_E1B19K-01        D-------
M0QVG6_E1B19K-01        D-------
X4YVU5_E1B19K-01        D-------
M0QUS9_E1B19K-01        D-------
G1FBW4_E1B19K-01        D-------
M0QVP5_E1B19K-01        D-------
T1UKQ0_E1B19K-01        D-------
W8CZB0_E1B19K-01        D-------
G1FC01_E1B19K-01        D-------
G3CK71_E1B19K-01        D-------
T1UGT5_E1B19K-01        D-------
T1UK99_E1B19K-01        D-------
M0QTS5_E1B19K-01        D-------
M0QV08_E1B19K-01        D-------
G9JUV5_E1B19K-01        D-------
T1UGX3_E1B19K-01        D-------
Q7T951_E1B19K-01        --------
T1UE63_E1B19K-01        --------
Q7T8D8_E1B19K-01        --------
Q8B8U7_E1B19K-01        --------
Q5UW22_E1B19K-01        --------
W6EIX6_E1B19K-01        --------
Q3ZL02_E1B19K-01        --------
A0A1L7NRH1_E1B19K-      --------
T1UFS4_E1B19K-01        --------
Q32UI6_E1B19K-01        --------
A0A7G5F9T0_E1B19K-      --------
C7SRS7_E1B19K-01        --------
J7H4R9_E1B19K-01        --------
D2DM83_E1B19K-01        --------
A0A7U3S1T6_E1B19K-      --------
A0A7U3S224_E1B19K-      --------
J7I6W7_E1B19K-01        --------
T1UJX4_E1B19K-01        --------
A0A7G5FB98_E1B19K-      --------
T2CI10_E1B19K-01        E-------
A0A0K0PX99_E1B19K-      E-------
A0A0K0PX35_E1B19K-      E-------
J7ID56_E1B19K-01        --------
A0A0B4SJH1_E1B19K-      --------
A0A075IQ70_E1B19K-      --------
Q2KS85_E1B19K-01        --------
Q3ZKW2_E1B19K-01        --------
K7NG43_E1B19K-01        --------
Q2KRU2_E1B19K-01        --------
A0A8B0LCV0_E1B19K-      --------
T1UIP3_E1B19K-01        --------
A0A8B0L9Y2_E1B19K-      --------
A0A6M6AA96_E1B19K-      --------
A0A220VZ73_E1B19K-      --------
A0A8B0LD36_E1B19K-      --------
A0A8B0LBX6_E1B19K-      --------
R4HLE1_E1B19K-01        --------
R4HMC6_E1B19K-01        --------
A0A897JQR0_E1B19K-      --------
I1V161_E1B19K-01        --------
P03248_E1B19K-02        --------
Q6RK98_E1B19K-01        --------
A0A5P8KYF0_E1B19K-      --------
J7I6Q4_E1B19K-01        --------
J7I6S4_E1B19K-01        --------
R4HLJ6_E1B19K-01        --------
R4HLA0_E1B19K-01        --------
Q2KSL3_E1B19K-01        --------
Q2Y0J3_E1B19K-01        --------
A0A5J6CTQ0_E1B19K-      --------
Q5EY83_E1B19K-01        --------
I6LEP5_E1B19K-01        --------
I6LES1_E1B19K-01        --------
T1UF50_E1B19K-01        --------
Q6QPF3_E1B19K-01        E-------
Q6QPB7_E1B19K-01        E-------
Q6QPI9_E1B19K-01        E-------
P10406_E1B19K-01        --------
Q5GFC7_E1B19K-02        --------
A0A2R3WN62_E1B19K-      --------
A0A3G9JTX5_E1B19K-      --------
Q2KSM8_E1B19K-02        --------
A0A2R3WNP3_E1B19K-      --------
Q2KSG6_E1B19K-02        --------
A0A2L1F392_E1B19K-      --------
A0A3G9CMQ4_E1B19K-      --------
Q5GFC7_E1B19K-01        --------
Q5GFC8_E1B19K-01        --------
Q6H1D7_E1B19K-01        --------
A0A3G8W6L2_E1B19K-      --------
A0A3G9K5X3_E1B19K-      --------
Q2KSG6_E1B19K-01        --------
Q2KSM8_E1B19K-01        --------
A0A2R3WN16_E1B19K-      --------
G9G841_E1B19K-01        --------
Q8UY91_E1B19K-01        --------
D3JIR7_E1B19K-01        --------
A0A076V686_E1B19K-      --------
A0A5H2QAX5_E1B19K-      --------
G1DE13_E1B19K-01        --------
D0Z5R9_E1B19K-01        --------
T1UEX7_E1B19K-01        --------
A0A3G8WH01_E1B19K-      --------
P04492_E1B19K-01        --------
A0A2H5AI99_E1B19K-      --------
A0A0M3TH31_E1B19K-      --------
M9YXY5_E1B19K-01        --------
M9YVF6_E1B19K-01        --------
A0MK43_E1B19K-01        --------
A0A2H5AI21_E1B19K-      --------
A0A0M5L3Y4_E1B19K-      --------
Q5C8R2_E1B19K-01        --------
A0A0A1EUB2_E1B19K-      --------
A0A0A1EUC8_E1B19K-      --------
A0A2H5AI04_E1B19K-      --------
A0A2H5AI72_E1B19K-      --------
A0A2H5AIL3_E1B19K-      --------
A0A2H4CJZ0_E1B19K-      --------
H8PFZ1_E1B19K-01        --------
A0A7U3RVU4_E1B19K-      --------
A0A142G3J2_E1B19K-      --------
P10543_E1B19K-01        --------
A0A6M6AEV2_E1B19K-      --------
A0A7U3RWV6_E1B19K-      --------
A0A1S6ELT2_E1B19K-      --------
A0A3G4W995_E1B19K-      --------
A0A898KBW7_E1B19K-      --------
A0A482EVC6_E1B19K-      --------
B5SNR1_E1B19K-01        --------
P10544_E1B19K-01        --------
W0S1G8_E1B19K-01        --------
A0A3G8W407_E1B19K-      --------
A0A898KBS1_E1B19K-      --------
F4ZCJ8_E1B19K-01        --------
A0A898KBR0_E1B19K-      --------
A0A6B9DS29_E1B19K-      --------
A0A6M6AES6_E1B19K-      --------
A0A7L4WGT1_E1B19K-      --------
A0A3S9SP19_E1B19K-      --------
A0A291P1B2_E1B19K-      --------
A0A5K6WAR5_E1B19K-      --------
T1UG63_E1B19K-01        --------
A0A1U9ALK7_E1B19K-      --------
A0A6M5E4Y6_E1B19K-      --------
P03247_E1B19K-01        --------
A0A3G8W3H5_E1B19K-      --------
E1U5L6_E1B19K-01        --------
A0A516UYI9_E1B19K-      --------
J9Z5H0_E1B19K-01        --------
A0A3S9SND6_E1B19K-      --------
J9Z4N4_E1B19K-01        --------
A0A3Q9HJZ5_E1B19K-      --------
A0A513TZR1_E1B19K-      --------
A0A516UYM9_E1B19K-      --------
A0A7L4WG90_E1B19K-      --------
J9Z4H6_E1B19K-01        --------
A0A6M4W5T4_E1B19K-      --------
A0A7L4WIG2_E1B19K-      --------
J7I6T8_E1B19K-01        --------
A0A7L4WK62_E1B19K-      --------
A0A3S9SNH4_E1B19K-      --------
Q6WQ37_E1B19K-01        --------
A0A7D0TN91_E1B19K-      --------
Q6VGV8_E1B19K-01        --------
A0A0G2R248_E1B19K-      --------
A0A3Q9HJ54_E1B19K-      --------
A0A3S9SSS2_E1B19K-      --------
A0A3S9SNY0_E1B19K-      --------
A0A2H4PJ75_E1B19K-      --------
A0A7D6TSN5_E1B19K-      --------
Q71BY5_E1B19K-04        --------
A0A4P2SGW2_E1B19K-      --------
A0A3Q9HJ63_E1B19K-      --------
A0A7L4WIC2_E1B19K-      --------
A0A7L4WJT1_E1B19K-      --------
A0A3Q9HLF7_E1B19K-      --------
E1ARN8_E1B19K-01        --------
P06501_E1B19K-01        --------
A0A0M4N3Z1_E1B19K-      --------
Q8B6X5_E1B19K-01        --------
H9AAD9_E1B19K-01        --------
H9AAH3_E1B19K-01        --------
H9AAA8_E1B19K-01        --------
M9YVA3_E1B19K-01        --------
F2WTJ7_E1B19K-01        D-------
F2WTM9_E1B19K-01        D-------
H9AA76_E1B19K-01        --------
A0A1C8EG46_E1B19K-      --------
H9AAN8_E1B19K-01        --------
H9AAS0_E1B19K-01        --------
H9AAV3_E1B19K-01        --------
H9AAY5_E1B19K-01        --------
A0A1L3INW0_E1B19K-      D-------
F6KST6_E1B19K-01        --------
F2WTG5_E1B19K-01        --------
Q695T5_E1B19K-01        --------
H9TER0_E1B19K-01        --------
Q5EY83_E1B19K-03        --------
E1U5L6_E1B19K-04        --------
E1ARN8_E1B19K-04        --------
Q5GFC7_E1B19K-05        --------
Q2KSG6_E1B19K-05        --------
Q2KSM8_E1B19K-05        --------
                                

© 1998-2022Legal notice