Dataset for protein adenoviridae of organism Human mastadenovirus F

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6B9DS29_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=167 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEENLRAG
LDPQTEL
© 1998-2020Legal notice