Dataset for protein adenoviridae of organism Human mastadenovirus F

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A6B9DS29_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=167 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEENLRAG
LDPQTEL
>gnl|bcl2dbpro|A0A6M6AES6_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=165 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEENLRAGLD
PQTEL
>gnl|bcl2dbpro|A0A6M6AEV2_E1B19K-01 E1B19K protein OS=[Viruses] Human mastadenovirus F GN=E1B19K (length=167 residues).
MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPGIFASLNLGHHSFFQEIVIRN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEEEEEEENLRAG
LDPSTEL
© 1998-2021Legal notice