Dataset for protein adenoviridae of organism Human mastadenovirus F

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6M6AEV2_E1B19K-      MELWSELQSYQNLRRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSR
A0A6B9DS29_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
A0A6M6AES6_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
                        **:********.*****************::**************:****

A0A6M6AEV2_E1B19K-      FADLLSHNPGIFASLNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFIL
A0A6B9DS29_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
A0A6M6AES6_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
                        **:***.*********************.*********************

A0A6M6AEV2_E1B19K-      DQWSAQTHLSQGYTLDYMAMALWRTLLRRKRVLGCLPAQRPHGLDPVQEE
A0A6B9DS29_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREE
A0A6M6AES6_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
                        **********:*******:**************** *** *******.  

A0A6M6AEV2_E1B19K-      EEEEENLRAGLDPSTEL
A0A6B9DS29_E1B19K-      EEEEENLRAGLDPQTEL
A0A6M6AES6_E1B19K-      EEEEENLRAGLDPQTEL
                        *************.***

© 1998-2021Legal notice