Dataset for protein adenoviridae of organism Human adenovirus F serotype 41

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A1S6ELT2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEERENL
RAGLDPQTEL
>gnl|bcl2dbpro|A0A3G4W995_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=166 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEENLRAGL
DPQTEL
>gnl|bcl2dbpro|A0A3G8W407_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=165 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEENLRAGLD
PQTEL
>gnl|bcl2dbpro|A0A482EVC6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSQFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEENL
RAGLDPQTEL
>gnl|bcl2dbpro|A0A482EVC6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=472 residues).
MERPNPSVGGVYSGLHDNGPVENPAAEEEGLRLLAGAASARSGSSAGGGGGGGGGGEPEGRSGSSNGIVTEPDPEEGTSS
GQRGEKRKLENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWELALNMFAKVA
LRPDTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFASTTQLTL
HGVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERCILAMVVEGQARIRHNAGSENVCFLLLKGT
ASVKHNMICGTGHSQLLTCADGNCQTLKVIHVVSHQRRPWPVFEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETDA
FSRVWWSGVFDLTIELYKVVRYDELKARCRPCECGANHIRLYPATLNVTEQLRTDHQMLSCLRTDYESSDED
>gnl|bcl2dbpro|A0A7U3RWV6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=158 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGVGLIWCVCIQESAYTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPTVREEEEEGEEN
>gnl|bcl2dbpro|A0A898KBR0_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=167 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEENLRAG
LDPQTEL
>gnl|bcl2dbpro|A0A898KBS1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=169 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEENLR
AGLDPQTEL
>gnl|bcl2dbpro|A0A898KBW7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=172 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRAVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEEEE
NLRAGLDPQTEL
>gnl|bcl2dbpro|B5SNR1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=170 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEENL
RAGLDPQTEL
>gnl|bcl2dbpro|F4ZCJ8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=171 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEEEEEN
LRAGLDPQTEL
>gnl|bcl2dbpro|P10544_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=168 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEENLRA
GLDPQTEL
>gnl|bcl2dbpro|W0S1G8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus F serotype 41 GN=E1B19K (length=168 residues).
MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFASLNLGHHSFFQEIVIKN
LDFSSPGRTVSGLAFICFILDQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREEEEEEEENLRA
GLDPQTEL
© 1998-2022Legal notice