Dataset for protein adenoviridae of organism Human adenovirus F serotype 41

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S6ELT2_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
A0A3G4W995_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
A0A482EVC6_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSQ
B5SNR1_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
P10544_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
W0S1G8_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
A0A3G8W407_E1B19K-      MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
F4ZCJ8_E1B19K-01        MEFWSELQSYQSLRRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSR
                        *************************************************.

A0A1S6ELT2_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
A0A3G4W995_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
A0A482EVC6_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
B5SNR1_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
P10544_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
W0S1G8_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
A0A3G8W407_E1B19K-      FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
F4ZCJ8_E1B19K-01        FAELLSFNPGIFASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFIL
                        **************************************************

A0A1S6ELT2_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR-E
A0A3G4W995_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
A0A482EVC6_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR-E
B5SNR1_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR-E
P10544_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
W0S1G8_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
A0A3G8W407_E1B19K-      DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVR--
F4ZCJ8_E1B19K-01        DQWSAQTHLSEGYTLDYMTMALWRTLLRRKRVLGCSPAQPPHGLDPVREE
                        ************************************************  

A0A1S6ELT2_E1B19K-      EEEEEEERENLRAGLDPQTEL
A0A3G4W995_E1B19K-      ---EEEEEENLRAGLDPQTEL
A0A482EVC6_E1B19K-      EEEEEEEEENLRAGLDPQTEL
B5SNR1_E1B19K-01        EEEEEEEEENLRAGLDPQTEL
P10544_E1B19K-01        -EEEEEEEENLRAGLDPQTEL
W0S1G8_E1B19K-01        -EEEEEEEENLRAGLDPQTEL
A0A3G8W407_E1B19K-      ----EEEEENLRAGLDPQTEL
F4ZCJ8_E1B19K-01        EEEEEEEEENLRAGLDPQTEL
                            *** *************

© 1998-2020Legal notice