Dataset for protein adenoviridae of organism Human adenovirus F serotype 41

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A482EVC6_E1B19K-      MERPNPSVGGVYSGLHDNGPVENPAAEEEGLRLLAGAASARSGSSAGGGG
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
                                                                          

A0A482EVC6_E1B19K-      GGGGGGEPEGRSGSSNGIVTEPDPEEGTSSGQRGEKRKLENDGADFLKEL
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
                                                                          

A0A482EVC6_E1B19K-      TLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWE
A0A7U3RWV6_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
A0A1S6ELT2_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
A0A3G4W995_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
A0A898KBW7_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
A0A482EVC6_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
B5SNR1_E1B19K-01        -----------MEFWSELQ--------------SYQSLR-----------
P10544_E1B19K-01        -----------MEFWSELQ--------------SYQSLR-----------
W0S1G8_E1B19K-01        -----------MEFWSELQ--------------SYQSLR-----------
A0A3G8W407_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
A0A898KBS1_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
F4ZCJ8_E1B19K-01        -----------MEFWSELQ--------------SYQSLR-----------
A0A898KBR0_E1B19K-      -----------MEFWSELQ--------------SYQSLR-----------
                                     :*::*:              .::.*.           

A0A482EVC6_E1B19K-      LALNMFAKVALRPDTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNC
A0A7U3RWV6_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A1S6ELT2_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A3G4W995_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A898KBW7_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A482EVC6_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSQF---------A
B5SNR1_E1B19K-01        ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
P10544_E1B19K-01        ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
W0S1G8_E1B19K-01        ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A3G8W407_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A898KBS1_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
F4ZCJ8_E1B19K-01        ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
A0A898KBR0_E1B19K-      ---RLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRF---------A
                           .::  .: *..: : :    .: :  *   :.   .*         .

A0A482EVC6_E1B19K-      AMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFASTTQLTLHGVFFQNCSG
A0A7U3RWV6_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A1S6ELT2_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A3G4W995_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A898KBW7_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A482EVC6_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
B5SNR1_E1B19K-01        ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
P10544_E1B19K-01        ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
W0S1G8_E1B19K-01        ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A3G8W407_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A898KBS1_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
F4ZCJ8_E1B19K-01        ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
A0A898KBR0_E1B19K-      ELLSFNPGI-------FASLNLGHHSFFQEIVIKNLDFSSPG--------
                         : *:.**:       * .:.:.  .*  ::. .. :::  *        

A0A482EVC6_E1B19K-      VCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERCILAMVVEGQ
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
                                                                          

A0A482EVC6_E1B19K-      ARIRHNAGSENVCFLLLKGTASVKHNMICGTGHSQLLTCADGNCQTLKVI
A0A7U3RWV6_E1B19K-      ---RTVSGVGLIWCVC----------------------------------
A0A1S6ELT2_E1B19K-      ---RTVSGLAFICFIL----------------------------------
A0A3G4W995_E1B19K-      ---RTVSGLAFICFIL----------------------------------
A0A898KBW7_E1B19K-      ---RAVSGLAFICFIL----------------------------------
A0A482EVC6_E1B19K-      ---RTVSGLAFICFIL----------------------------------
B5SNR1_E1B19K-01        ---RTVSGLAFICFIL----------------------------------
P10544_E1B19K-01        ---RTVSGLAFICFIL----------------------------------
W0S1G8_E1B19K-01        ---RTVSGLAFICFIL----------------------------------
A0A3G8W407_E1B19K-      ---RTVSGLAFICFIL----------------------------------
A0A898KBS1_E1B19K-      ---RTVSGLAFICFIL----------------------------------
F4ZCJ8_E1B19K-01        ---RTVSGLAFICFIL----------------------------------
A0A898KBR0_E1B19K-      ---RTVSGLAFICFIL----------------------------------
                           *  :*   :  :                                   

A0A482EVC6_E1B19K-      HVVSHQRRPWPVFEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETDA
A0A7U3RWV6_E1B19K-      -------IQESAYTH---------------LSEGYTLDY-----------
A0A1S6ELT2_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
A0A3G4W995_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
A0A898KBW7_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
A0A482EVC6_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
B5SNR1_E1B19K-01        -------DQWSAQTH---------------LSEGYTLDY-----------
P10544_E1B19K-01        -------DQWSAQTH---------------LSEGYTLDY-----------
W0S1G8_E1B19K-01        -------DQWSAQTH---------------LSEGYTLDY-----------
A0A3G8W407_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
A0A898KBS1_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
F4ZCJ8_E1B19K-01        -------DQWSAQTH---------------LSEGYTLDY-----------
A0A898KBR0_E1B19K-      -------DQWSAQTH---------------LSEGYTLDY-----------
                                  ..  *               : . *  ::           

A0A482EVC6_E1B19K-      FSRVWWSGVFDLTIELYKVVRYDELKARCRPCECGANHIRLYPATLNVTE
A0A7U3RWV6_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPTV
A0A1S6ELT2_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A3G4W995_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A898KBW7_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A482EVC6_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
B5SNR1_E1B19K-01        -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
P10544_E1B19K-01        -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
W0S1G8_E1B19K-01        -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A3G8W407_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A898KBS1_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
F4ZCJ8_E1B19K-01        -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
A0A898KBR0_E1B19K-      -----------MTMALWRTLLRRKRVLGCSPAQP--------PHGLDPVR
                                   :*: *:..:   :    * *.:         *  *: . 

A0A482EVC6_E1B19K-      --QLRTDHQMLSCLRTDYESSDED
A0A7U3RWV6_E1B19K-      ---REEEEEGEEN-----------
A0A1S6ELT2_E1B19K-      --EEEEEEEERENLRAGLDPQTEL
A0A3G4W995_E1B19K-      ------EEEEEENLRAGLDPQTEL
A0A898KBW7_E1B19K-      EEEEEEEEEEEENLRAGLDPQTEL
A0A482EVC6_E1B19K-      --EEEEEEEEEENLRAGLDPQTEL
B5SNR1_E1B19K-01        --EEEEEEEEEENLRAGLDPQTEL
P10544_E1B19K-01        ----EEEEEEEENLRAGLDPQTEL
W0S1G8_E1B19K-01        ----EEEEEEEENLRAGLDPQTEL
A0A3G8W407_E1B19K-      -------EEEEENLRAGLDPQTEL
A0A898KBS1_E1B19K-      ---EEEEEEEEENLRAGLDPQTEL
F4ZCJ8_E1B19K-01        -EEEEEEEEEEENLRAGLDPQTEL
A0A898KBR0_E1B19K-      -----EEEEEEENLRAGLDPQTEL
                                :  .            

© 1998-2022Legal notice