Dataset for protein adenoviridae of organism Human adenovirus E serotype 4

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bcl2dbpro|A0A3G8W6L2_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQRQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|P10406_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPSLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q2KSG6_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=494 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLFPELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQMTGTDEVSVMHEKFSLEQVKTCW
LEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRF
RGDGYNGTVMANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHNVMTRCNMHLGARRG
MLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVNVTEDLRPDHLVLS
CTGTEFGSSGEESD
>gnl|bcl2dbpro|Q2KSG6_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=166 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLFPELRRVLTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVNVTEDLRPDHLVLSCTGTEFGS
SGEESD
>gnl|bcl2dbpro|Q2KSG6_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=88 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GVADLPCV
>gnl|bcl2dbpro|Q2KSG6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=183 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEE
>gnl|bcl2dbpro|Q2KSG6_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=139 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAICRYSR
>gnl|bcl2dbpro|Q2KSM8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=184 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQR
RQQQQEDQEENPRAGLDPPAEEEE
>gnl|bcl2dbpro|Q2KSM8_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFVLDKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q2KSM8_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=91 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLPCVWM
>gnl|bcl2dbpro|Q2KSM8_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=496 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLFPELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQLTGTDEVSVMHEKFSLEQVKTC
WLEPEDDWEVAIRNYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIR
FRGDGYNGTVFMANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEA
RIRHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHNVMTRCNMHLGAR
RGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLV
LSCTGTEFGSSGEESD
>gnl|bcl2dbpro|Q2KSM8_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=167 residues).
MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSEDPKSPANFPGTPTPPAAAGGSRREPESRPGPSGGG
GGVADLFPELRRVLTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFG
SSGEESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-03 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=483 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLFPELHRV
LTRSSSGRERGIKRERHDETNHRIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIR
NYAKLALRPDRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMA
NTKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCF
VLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEHNVMTRCNMHLGARRGMFMPYQCNLNY
VKVLLEPDVMSRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGE
ESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
>gnl|bcl2dbpro|Q5GFC7_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=142 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
>gnl|bcl2dbpro|Q5GFC7_E1B19K-04 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=154 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLFPELHRV
LTRVSLTGVFDMNVEVWKILRYDEYKTRCRACECGGKHARFQPVCVDVTEDLRPDHLVLSCTGTEFGSSGEESD
>gnl|bcl2dbpro|Q5GFC7_E1B19K-05 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=78 residues).
MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSEDPESPAAGGSRRESESRPGPSGGGVADLPCVWM
>gnl|bcl2dbpro|Q5GFC8_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus E serotype 4 GN=E1B19K (length=171 residues).
MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFDALNLGHQSHFNQRISRA
LDFTTPGRTTAAVAFFAFIFDKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILSLQQQEDQEEN
PRAGLDPPAEE
© 1998-2021Legal notice