Dataset for protein adenoviridae of organism Human adenovirus E serotype 4

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q5GFC7_E1B19K-03        MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSED----
Q2KSG6_E1B19K-03        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
Q2KSM8_E1B19K-03        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
A0A3G8W6L2_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSG6_E1B19K-01        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-01        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q5GFC7_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
Q5GFC8_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
P10406_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQ
Q5GFC7_E1B19K-02        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
Q2KSG6_E1B19K-02        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-02        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-04        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
Q2KSG6_E1B19K-04        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
Q5GFC7_E1B19K-04        MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSED----
Q5GFC7_E1B19K-05        MESRNPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTAARHSED----
Q2KSG6_E1B19K-05        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
Q2KSM8_E1B19K-05        MESRNPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTAARHSED----
                        ** .. :::   .  * ..  :.:.     *    **  . * .:*    

Q5GFC7_E1B19K-03        -----PESP-----------AAGGSRRESE---SRPGPS--GGGVADLFP
Q2KSG6_E1B19K-03        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPS-GGGGVADLFP
Q2KSM8_E1B19K-03        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPSGGGGGVADLFP
A0A3G8W6L2_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSG6_E1B19K-01        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-01        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q5GFC7_E1B19K-01        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q5GFC8_E1B19K-01        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
P10406_E1B19K-01        FEDILRECPSLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q5GFC7_E1B19K-02        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q2KSG6_E1B19K-02        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-02        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-04        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPSGGGGGVADLFP
Q2KSG6_E1B19K-04        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPS-GGGGVADLFP
Q5GFC7_E1B19K-04        -----PESP-----------AAGGSRRESE---SRPGPS--GGGVADLFP
Q5GFC7_E1B19K-05        -----PESP-----------AAGGSRRESE---SRPGPS--GGGVADL--
Q2KSG6_E1B19K-05        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPS-GGGGVADL--
Q2KSM8_E1B19K-05        -----PKSPANFPGTPTPPAAAGGSRREPE---SRPGPSGGGGGVADL--
                              :.*           :  ..* .     : ** :  . ..  :  

Q5GFC7_E1B19K-03        ELHRVLTRSSSGRERGIKRERHDETNHRIELTVGLMSRKRPETVWWYEVQ
Q2KSG6_E1B19K-03        ELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQ
Q2KSM8_E1B19K-03        ELRRVLTRSLSGRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQ
A0A3G8W6L2_E1B19K-      DKWSQET-------------------------------------------
Q2KSG6_E1B19K-01        DKWSQET-------------------------------------------
Q2KSM8_E1B19K-01        DKWSQET-------------------------------------------
Q5GFC7_E1B19K-01        DKWSQET-------------------------------------------
Q5GFC8_E1B19K-01        DKWSQET-------------------------------------------
P10406_E1B19K-01        DKWSQET-------------------------------------------
Q5GFC7_E1B19K-02        DKWSQET-------------------------------------------
Q2KSG6_E1B19K-02        DKWSQET-------------------------------------------
Q2KSM8_E1B19K-02        DKWSQET-------------------------------------------
Q2KSM8_E1B19K-04        ELRRVLT-------------------------------------------
Q2KSG6_E1B19K-04        ELRRVLT-------------------------------------------
Q5GFC7_E1B19K-04        ELHRVLT-------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        STGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIRNYAKLALRPDRKYKI
Q2KSG6_E1B19K-03        MTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEVAIRNYAKLALRPDRKYKI
Q2KSM8_E1B19K-03        LTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEVAIRNYAKLALRPDRKYKI
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        TKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMN
Q2KSG6_E1B19K-03        TKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMN
Q2KSM8_E1B19K-03        TKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMN
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        MRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSAN
Q2KSG6_E1B19K-03        IRFRGDGYNGTV-MANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSAN
Q2KSM8_E1B19K-03        IRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSAN
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        WMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCFVLCKG
Q2KSG6_E1B19K-03        WMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCFVLCKG
Q2KSM8_E1B19K-03        WMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETGCFVLCKG
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        NAKIKHNMICGASDERGYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEHN
Q2KSG6_E1B19K-03        NAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHN
Q2KSM8_E1B19K-03        NAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHPRKPWPEFEHN
A0A3G8W6L2_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        VMTRCNMHLGARRGMFMPYQCNLNYVKVLLEPDVMSRVSLTGVFD-MNVE
Q2KSG6_E1B19K-03        VMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFD-MNVE
Q2KSM8_E1B19K-03        VMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFD-MNVE
A0A3G8W6L2_E1B19K-      ------------------------------------HFSRDYQLDFLAVA
Q2KSG6_E1B19K-01        ------------------------------------HFSRDYQLDFLAVA
Q2KSM8_E1B19K-01        ------------------------------------HFSRDYQLDFLAVA
Q5GFC7_E1B19K-01        ------------------------------------HFSRDYQLDFLAVA
Q5GFC8_E1B19K-01        ------------------------------------HFSRDYQLDFLAVA
P10406_E1B19K-01        ------------------------------------HFSRDYQLDFLAVA
Q5GFC7_E1B19K-02        ------------------------------------HFSRDYQLDFLAVA
Q2KSG6_E1B19K-02        ------------------------------------HFSRDYQLDFLAVA
Q2KSM8_E1B19K-02        ------------------------------------HFSRDYQLDFLAVA
Q2KSM8_E1B19K-04        ------------------------------------RVSLTGVFD-MNVE
Q2KSG6_E1B19K-04        ------------------------------------RVSLTGVFD-MNVE
Q5GFC7_E1B19K-04        ------------------------------------RVSLTGVFD-MNVE
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
                                                                          

Q5GFC7_E1B19K-03        VWKILRYDEYKTRCRACECGG----KHARFQPVCVDVTEDLRPDHLVLSC
Q2KSG6_E1B19K-03        VWKILRYDEYKTRCRACECGG----KHARFQPVCVNVTEDLRPDHLVLSC
Q2KSM8_E1B19K-03        VWKILRYDEYKTRCRACECGG----KHARFQPVCVDVTEDLRPDHLVLSC
A0A3G8W6L2_E1B19K-      LWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQRRQRQQEDQEEN
Q2KSG6_E1B19K-01        LWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQRRQQQQEDQEEN
Q2KSM8_E1B19K-01        LWRAWKCQRLNAISGYLPVQPLDTLRILSLQQISQERQRRQQQQEDQEEN
Q5GFC7_E1B19K-01        LWRTWKCQRLNAISGYLPVQPLDTLRILSLQ-----------QQEDQEEN
Q5GFC8_E1B19K-01        LWRTWKCQRLNAISGYLPVQPLDTLRILSLQ-----------QQEDQEEN
P10406_E1B19K-01        LWRTWKCQRLNAIPATCRYSR-----------------------------
Q5GFC7_E1B19K-02        LWRTWKCQRLNAIPATCRYSR-----------------------------
Q2KSG6_E1B19K-02        LWRAWKCQRLNAI---CRYSR-----------------------------
Q2KSM8_E1B19K-02        LWRAWKCQRLNAIPATCRYSR-----------------------------
Q2KSM8_E1B19K-04        VWKILRYDEYKTRCRACECGG----KHARFQPVCVDVTEDLRPDHLVLSC
Q2KSG6_E1B19K-04        VWKILRYDEYKTRCRACECGG----KHARFQPVCVNVTEDLRPDHLVLSC
Q5GFC7_E1B19K-04        VWKILRYDEYKTRCRACECGG----KHARFQPVCVDVTEDLRPDHLVLSC
Q5GFC7_E1B19K-05        --------------------------------PCVWM-------------
Q2KSG6_E1B19K-05        --------------------------------PCV---------------
Q2KSM8_E1B19K-05        --------------------------------PCVWM-------------
                                                                          

Q5GFC7_E1B19K-03        TGTEFGSSGEESD
Q2KSG6_E1B19K-03        TGTEFGSSGEESD
Q2KSM8_E1B19K-03        TGTEFGSSGEESD
A0A3G8W6L2_E1B19K-      PRAGLDPPAEEEE
Q2KSG6_E1B19K-01        PRAGLDPPAEEE-
Q2KSM8_E1B19K-01        PRAGLDPPAEEEE
Q5GFC7_E1B19K-01        PRAGLDPPAEE--
Q5GFC8_E1B19K-01        PRAGLDPPAEE--
P10406_E1B19K-01        -------------
Q5GFC7_E1B19K-02        -------------
Q2KSG6_E1B19K-02        -------------
Q2KSM8_E1B19K-02        -------------
Q2KSM8_E1B19K-04        TGTEFGSSGEESD
Q2KSG6_E1B19K-04        TGTEFGSSGEESD
Q5GFC7_E1B19K-04        TGTEFGSSGEESD
Q5GFC7_E1B19K-05        -------------
Q2KSG6_E1B19K-05        -------------
Q2KSM8_E1B19K-05        -------------
                                     

© 1998-2021Legal notice