Dataset for protein Mcl-1 of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A673GSK0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=278 residues).
MLKIQLRITEINYSLTDIHIENSYFKYLVRRTAAVSLLGAHTALVPAPALKPRSEDELDGCADEPDAAVKPVRPGTNGLK
GLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYRTHTGMCPQDRKQHHALPTMTRVVADVLLKHETTFKGM
LQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLLNNK
HGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673GSK0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=206 residues).
IPGTNGLKGLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYRTHTGMCPQDRKQHHALPTMTRVVADVLLK
HETTFKGMLQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQ
HDWLLNNKHGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673GSK0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=235 residues).
LSFNLRRSDRLEDELDGCADEPDAAVKPVRPGTNGLKGLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYR
THTGMCPQDRKQHHALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAV
VCSRLKELQRERCVETVTQQISSYLISEQHDWLLNNKHGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673HSI2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=230 residues).
MTLSLGNRPMAALGVLADETDAALKPLRPGTNGLKGLQLDGRFVSAGDGSLPATPDPQELGSDTQQLLLDFYRTHTGMSL
PDRKRHHALPTMKRVVADVLIKHQITYTGMLQRLQLDSQPDDLSVIDCIAKTMFRDDTTNWGRIVSLVAFGAVVCSQLKE
LQRERCVETVAQQISSYLISEQHDWLLNNKGWHGFEEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A673IXK8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=248 residues).
MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEM
DTREIIDIFLKNFTGFPHSKSGNKQVLATMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWG
RIASLLTLGAMVCKHQNDKGLSKCASLVGKEISSYLLITQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFG
AALAYLIR
>gnl|bcl2dbpro|A0A673MXF5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=247 residues).
MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGSVPSSPETDCEEIDDYTSIYAALEMD
TREIIDAFLKSFTGLPHSKSGKNQVLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGR
ICSLLTFGALVCKHQNDRGLSKCVSLVGEEISSYLLTDQRDWLLKNKAWDGFVAFFHVPDTEAAMRNTLMAIGGVATFGA
ALAYLIR
© 1998-2020Legal notice