Dataset for protein Mcl-1 of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673IXK8_MCL1-01      ---------------------------------------------MFPGS
A0A673MXF5_MCL1-01      ---------------------------------------------MFPGS
A0A673GSK0_MCL1-03      -------------------------------------------LSFNLRR
A0A673HSI2_MCL1-01      ---------------------------------------------MTLSL
A0A673GSK0_MCL1-01      MLKIQLRITEINYSLTDIHIENSYFKYLVRRTAAVSLLGAHTALVPAPAL
A0A673GSK0_MCL1-02      --------------------------------------------------
                                                                          

A0A673IXK8_MCL1-01      KVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGS
A0A673MXF5_MCL1-01      KVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGS
A0A673GSK0_MCL1-03      SDRLEDELDGCADEPDAAVKPVRPGTNG----LKGLQLDGRFVCAA-DGS
A0A673HSI2_MCL1-01      GNRPMAALGVLADETDAALKPLRPGTNG----LKGLQLDGRFVSAG-DGS
A0A673GSK0_MCL1-01      KPRSEDELDGCADEPDAAVKPVRPGTNG----LKGLQLDGRFVCAA-DGS
A0A673GSK0_MCL1-02      ----------------------IPGTNG----LKGLQLDGRFVCAA-DGS
                                                * .     :  *: :..*.  . :**

A0A673IXK8_MCL1-01      VPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIFLKNFTGFPHSKSGNKQ
A0A673MXF5_MCL1-01      VPSSPETDCEEI-DDYTSIYAALEMDTREIIDAFLKSFTGLPHSKSGKNQ
A0A673GSK0_MCL1-03      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
A0A673HSI2_MCL1-01      LPATPDP------QELGS-------DTQQLLLDFYRTHTGMSLPDRKRHH
A0A673GSK0_MCL1-01      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
A0A673GSK0_MCL1-02      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
                        :* :*:.      ::  *       **.:::  * ...**:   .  .::

A0A673IXK8_MCL1-01      VLATMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDG
A0A673MXF5_MCL1-01      VLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDG
A0A673GSK0_MCL1-03      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
A0A673HSI2_MCL1-01      ALPTMKRVVADVLIKHQITYTGMLQRLQLDSQPDDLSVIDCIAKTMFRDD
A0A673GSK0_MCL1-01      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
A0A673GSK0_MCL1-02      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
                        .*.**.*** .: :**: ::.**: **:*:.: :*:*.:. :*  :* *.

A0A673IXK8_MCL1-01      ITNWGRIASLLTLGAMVCKHQNDKGLSKCASLVGKEISSYLLITQRDWLL
A0A673MXF5_MCL1-01      ITNWGRICSLLTFGALVCKHQNDRGLSKCVSLVGEEISSYLLTDQRDWLL
A0A673GSK0_MCL1-03      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
A0A673HSI2_MCL1-01      TTNWGRIVSLVAFGAVVCSQLKELQRERCVETVAQQISSYLISEQHDWLL
A0A673GSK0_MCL1-01      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
A0A673GSK0_MCL1-02      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
                         ****** **:::**:**.. ::   ..*.. * ::*****:  *.****

A0A673IXK8_MCL1-01      KNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFGAALAYLIR
A0A673MXF5_MCL1-01      KNKAWDGFVAFFHVPDTEAAMRNTLMAIGGVATFGAALAYLIR
A0A673GSK0_MCL1-03      NNK--HGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
A0A673HSI2_MCL1-01      NNKGWHGFEEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
A0A673GSK0_MCL1-01      NNK--HGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
A0A673GSK0_MCL1-02      NNK--HGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
                        :*:   **  **.* :.*:.:*.:***: . * :**.** ***

© 1998-2020Legal notice